Citrus Sinensis ID: 024959

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260
MAAAAKDSSSGGATSSVKGVLTHGGKYVQYNVYGNLFEVSSKYVPPIRPIGRGAYGIVCAAVNSETREEVAIKKIGNAFDNIIDARRTLREIKLLRHMEHENVIAIKDIIRPPKKDTFNDVYIVYELMDTDLHQIIRSDQQLTDDHCQYFLYQLLRGLKYVHSASVLHRDLKPSNLLLNASCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILGEIMTREPLFPGKDYVHQLRLITEV
ccccccccccccccccccccccccccEEEEEEcccEEEEccccccccccccccccEEEEEEEEcccccEEEEEEcccccccHHHHHHHHHHHHHHcccccccccccccccccccccccccEEEEEEccccHHHHHHHccccccHHHHHHHHHHHHHHHHcHHcccccccccccccEEccccccEEccccccccccccccccccccccccccccHHccccccccccHHHHHHHHHHHHHHccccccccccHHHHHHHHHcc
***********************GGKYVQYNVYGNLFEVSSKYVPPIRPIGRGAYGIVCAAVNSETREEVAIKKIGNAFDNIIDARRTLREIKLLRHMEHENVIAIKDIIRPPKKDTFNDVYIVYELMDTDLHQIIRSDQQLTDDHCQYFLYQLLRGLKYVHSASVLHRDLKPSNLLLNASCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILGEIMTREPLFPGKDYVHQLRLITEV
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAAAKDSSSGGATSSVKGVLTHGGKYVQYNVYGNLFEVSSKYVPPIRPIGRGAYGIVCAAVNSETREEVAIKKIGNAFDNIIDARRTLREIKLLRHMEHENVIAIKDIIRPPKKDTFNDVYIVYELMDTDLHQIIRSDQQLTDDHCQYFLYQLLRGLKYVHSASVLHRDLKPSNLLLNASCDLKIGDFGLARTTSETDFMTEYVVTRWYRAPELLLNCTEYTAAIDIWSVGCILGEIMTREPLFPGKDYVHQLRLITEV

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Mitogen-activated protein kinase 4 Involved in cortical microtubules organization and stabilization by regulating the phosphorylation state of microtubule-associated proteins such as MAP65-1. Involved in root hair development process. Negative regulator of systemic acquired resistance (SAR) and salicylic acid- (SA) mediated defense response. Required for jasmonic acid- (JA) mediated defense gene expression. May regulate activity of transcription factor controlling pathogenesis-related (PR) gene expression. Seems to act independently of the SAR regulatory protein NPR1 (Nonexpresser of PR1). Phosphorylates MKS1 and transcription factors WRKY25 and WRKY33. May be involved in the cold and salinity stress-mediated MAP kinase signaling cascade (MEKK1, MEK1/MKK2 and MPK4/MPK6). May act as negative regulator of salt tolerance.probableQ39024
Mitogen-activated protein kinase 2 probableQ5J4W4
Mitogen-activated protein kinase homolog NTF6 probableQ40531

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.24Mitogen-activated protein kinase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1CM8, chain A
Confidence level:very confident
Coverage over the Query: 31-259
View the alignment between query and template
View the model in PyMOL