Citrus Sinensis ID: 024993

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKVLYSSSTVEIQEENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLGFNQQPKIDLPIFQ
cEEEEEEccccHHHHHHHHHHcccCEEEEccccccccccEEEEccccHHHHHHHHHHcccHHHHHHHHHccccCECcHHHHHHHHHHHcccccccccccccEEEEEEccccccccccccccccccccccccccccccCEEEEcccEEEEcccccEEEEEECccccccccccccccHHHHcccccccEEEEEEEccEEEEECccccccccHHHHHHHHHHHHHccccccccccccccEEEcccccccccccccccccccc
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKVLYSSSTVEIQEENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMM*********************************IDLPIFQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVVGVLALQGSFNEHIAALKRLGVKGVEIRKPDQLQNVSSLIIPGGESTTMARLAEYHNLFPALREFVKMGKPVWGTCAGLIFLANKAVGQKLGGQELVGGLDCTVHRNFFGSQIQSFEAELSVPALASQEGGPETFRGVFIRAPAVLDVGPDVDVLADYPVPSNKVLYSSSTVEIQEENAMPEKKVIVAVRQGNLLGTAFHPELTADTRWHSYFLKMMSEVGEGTSSGGKGTSSGIVVVGGENLGFNQQPKIDLPIFQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pyridoxal biosynthesis protein PDX2 Involved in the production of pyridoxal (vitamin B6) and indirect resistance to singlet oxygen-generating photosensitizers.confidentQ8LAD0
Glutamine amidotransferase subunit PdxT Involved in the hydrolysis of glutamine to glutamate and ammonia. Channels an ammonia molecule to PdxS.probableB8H9E0

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YWD, chain A
Confidence level:very confident
Coverage over the Query: 1-126,142-220
View the alignment between query and template
View the model in PyMOL
Template: 2ABW, chain A
Confidence level:very confident
Coverage over the Query: 1-128,146-222
View the alignment between query and template
View the model in PyMOL