Query         025004
Match_columns 259
No_of_seqs    114 out of 132
Neff          4.3 
Searched_HMMs 46136
Date          Fri Mar 29 09:11:17 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025004.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025004hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF04505 Dispanin:  Interferon-  88.5    0.16 3.4E-06   39.4   0.4   18  234-251    25-43  (82)
  2 PF02326 YMF19:  Plant ATP synt  58.4      15 0.00033   28.8   3.8   30  205-248    10-39  (86)
  3 KOG2927 Membrane component of   55.3      38 0.00083   33.4   6.7   13  237-249   239-251 (372)
  4 COG3671 Predicted membrane pro  54.2      55  0.0012   27.8   6.6   47  208-254    70-116 (125)
  5 PF02656 DUF202:  Domain of unk  51.9      60  0.0013   23.7   5.9   49   82-130    17-70  (73)
  6 PF10329 DUF2417:  Region of un  46.1      98  0.0021   28.7   7.5   80  168-251    35-123 (232)
  7 PF13748 ABC_membrane_3:  ABC t  43.5      59  0.0013   30.3   5.7   73   52-133    75-164 (237)
  8 PTZ00201 amastin surface glyco  38.9      48   0.001   29.9   4.2   21  222-242    84-104 (192)
  9 PHA03283 envelope glycoprotein  37.9      28 0.00062   35.9   2.9   28  106-133   397-431 (542)
 10 PF11712 Vma12:  Endoplasmic re  37.5      55  0.0012   27.3   4.2   27  166-192    78-104 (142)
 11 PF11368 DUF3169:  Protein of u  35.8 1.1E+02  0.0024   27.6   6.2   17  202-218   126-142 (248)
 12 PF05478 Prominin:  Prominin;    34.9      44 0.00094   35.6   3.9   29  207-239    89-117 (806)
 13 KOG1935 Membrane protein Patch  33.8      40 0.00088   37.1   3.4   40  209-248  1026-1071(1143)
 14 PF02985 HEAT:  HEAT repeat;  I  28.2      32 0.00068   21.3   1.0   19   45-63      8-26  (31)
 15 MTH00169 ATP8 ATP synthase F0   27.5      99  0.0021   23.3   3.7   14  204-217    10-23  (67)
 16 PF05961 Chordopox_A13L:  Chord  27.3      74  0.0016   24.5   3.0   14  239-252    11-24  (68)
 17 PF12326 EOS1:  N-glycosylation  26.8 2.1E+02  0.0045   25.0   6.0   43   86-131    51-94  (148)
 18 PHA03049 IMV membrane protein;  25.7      82  0.0018   24.2   3.0   12  241-252    13-24  (68)
 19 smart00714 LITAF Possible memb  25.5      69  0.0015   23.3   2.5    9  236-244    37-45  (67)
 20 PF01534 Frizzled:  Frizzled/Sm  25.3 3.2E+02   0.007   26.3   7.7   29  170-198    96-125 (328)
 21 TIGR02741 TraQ type-F conjugat  25.2      64  0.0014   25.4   2.3   22   69-94     32-53  (80)
 22 PF01036 Bac_rhodopsin:  Bacter  24.3 2.7E+02  0.0059   24.6   6.5  126   63-225    72-208 (222)
 23 PF10601 zf-LITAF-like:  LITAF-  24.1      89  0.0019   23.0   2.9   15  230-244    37-51  (73)
 24 PF06814 Lung_7-TM_R:  Lung sev  22.9 5.9E+02   0.013   23.3  11.3  122   72-220    45-167 (295)
 25 PF02932 Neur_chan_memb:  Neuro  22.5 2.4E+02  0.0051   22.1   5.3   12  213-224    33-44  (237)
 26 PF02411 MerT:  MerT mercuric t  22.3      80  0.0017   26.2   2.6   18  231-248    18-35  (116)
 27 PF09125 COX2-transmemb:  Cytoc  22.1      51  0.0011   22.7   1.1   22   69-90     11-32  (38)
 28 PF08370 PDR_assoc:  Plant PDR   21.7      66  0.0014   24.2   1.8   16  206-221    27-43  (65)
 29 PRK14010 potassium-transportin  21.5   2E+02  0.0043   30.4   5.8   41  208-249   223-269 (673)
 30 PRK14749 hypothetical protein;  20.5 1.7E+02  0.0038   19.2   3.3   23  106-128     4-27  (30)

No 1  
>PF04505 Dispanin:  Interferon-induced transmembrane protein;  InterPro: IPR007593 This family includes the human leukocyte antigen CD225, which is an interferon inducible transmembrane protein, and is associated with interferon induced cell growth suppression [].; GO: 0009607 response to biotic stimulus, 0016021 integral to membrane
Probab=88.54  E-value=0.16  Score=39.37  Aligned_cols=18  Identities=50%  Similarity=1.202  Sum_probs=13.3

Q ss_pred             HHHHhhHH-HHHHHHHHhh
Q 025004          234 IALCCCLP-CIIAILYAVA  251 (259)
Q Consensus       234 ialCCCLP-cIIaiLyav~  251 (259)
                      ..+|||+| -|++|.|+..
T Consensus        25 s~l~Cc~PlGi~Ai~~s~k   43 (82)
T PF04505_consen   25 STLCCCWPLGIVAIVYSSK   43 (82)
T ss_pred             HHHHHHhhHHHHHheechh
Confidence            34599999 4777878776


No 2  
>PF02326 YMF19:  Plant ATP synthase F0;  InterPro: IPR003319 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   F-ATPases (also known as F1F0-ATPase, or H(+)-transporting two-sector ATPase) (3.6.3.14 from EC) are composed of two linked complexes: the F1 ATPase complex is the catalytic core and is composed of 5 subunits (alpha, beta, gamma, delta, epsilon), while the F0 ATPase complex is the membrane-embedded proton channel that is composed of at least 3 subunits (A-C), nine in mitochondria (A-G, F6, F8). Both the F1 and F0 complexes are rotary motors that are coupled back-to-back. In the F1 complex, the central gamma subunit forms the rotor inside the cylinder made of the alpha(3)beta(3) subunits, while in the F0 complex, the ring-shaped C subunits forms the rotor. The two rotors rotate in opposite directions, but the F0 rotor is usually stronger, using the force from the proton gradient to push the F1 rotor in reverse in order to drive ATP synthesis []. These ATPases can also work in reverse to hydrolyse ATP to create a proton gradient. This entry represents subunit 8 (or ymf19) found in the F0 complex of mitochondrial F-ATPases from plants and algae. This subunit is sometimes found in association and N-terminal to IPR009455 from INTERPRO, in higher plants. Subunit 8 differs in sequence between plants, Metazoa (IPR001421 from INTERPRO) and fungi (IPR009230 from INTERPRO) [, ]. More information about this protein can be found at Protein of the Month: ATP Synthases [].; GO: 0015078 hydrogen ion transmembrane transporter activity, 0015986 ATP synthesis coupled proton transport, 0000276 mitochondrial proton-transporting ATP synthase complex, coupling factor F(o)
Probab=58.44  E-value=15  Score=28.77  Aligned_cols=30  Identities=33%  Similarity=0.699  Sum_probs=20.1

Q ss_pred             chhHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHH
Q 025004          205 PRLYWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILY  248 (259)
Q Consensus       205 P~LYwLcivFLAFd~ifvvfcyal~cli~ialCCCLPcIIaiLy  248 (259)
                      +|.+|+|+.|++|=.+++              -..||-|..+|-
T Consensus        10 sQ~fW~~i~f~~~y~~~~--------------~~~lP~i~~~lk   39 (86)
T PF02326_consen   10 SQYFWLLIFFFFFYIFLV--------------NFILPKISRILK   39 (86)
T ss_pred             HHHHHHHHHHHHHHHHHH--------------HHHHHHHHHHHH
Confidence            577899999886544421              346787777663


No 3  
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=55.31  E-value=38  Score=33.45  Aligned_cols=13  Identities=31%  Similarity=-0.003  Sum_probs=8.4

Q ss_pred             HhhHHHHHHHHHH
Q 025004          237 CCCLPCIIAILYA  249 (259)
Q Consensus       237 CCCLPcIIaiLya  249 (259)
                      =|.|-||++|||-
T Consensus       239 RlILF~I~~il~~  251 (372)
T KOG2927|consen  239 RLILFGITWILTG  251 (372)
T ss_pred             HHHHHHHHHHHhC
Confidence            3556667777764


No 4  
>COG3671 Predicted membrane protein [Function unknown]
Probab=54.22  E-value=55  Score=27.83  Aligned_cols=47  Identities=17%  Similarity=0.492  Sum_probs=39.7

Q ss_pred             HHHHHHHHhhhhHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHhhccc
Q 025004          208 YWLAVVFLAFDVFFAIFCVVLACLIGIALCCCLPCIIAILYAVAGQV  254 (259)
Q Consensus       208 YwLcivFLAFd~ifvvfcyal~cli~ialCCCLPcIIaiLyav~~qe  254 (259)
                      ||+|+.+--.+.++..++..+..++...+-..+=|++.+.|-..||-
T Consensus        70 Fw~~vl~~iIg~Llt~lgiGv~i~~AlgvW~i~Riv~G~~yl~~g~a  116 (125)
T COG3671          70 FWLAVLWWIIGLLLTFLGIGVVILVALGVWYIYRIVIGFKYLNEGKA  116 (125)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCc
Confidence            58888887777777777888888888999999999999999888763


No 5  
>PF02656 DUF202:  Domain of unknown function (DUF202);  InterPro: IPR003807 This entry describes proteins of unknown function.
Probab=51.92  E-value=60  Score=23.68  Aligned_cols=49  Identities=33%  Similarity=0.386  Sum_probs=31.9

Q ss_pred             HHHHHHHHHHHHHhccCCCCCc---hHHHHHHHhhhhHHHHHHHHH--HHHHHh
Q 025004           82 NSAFVIVSAAMLIITINERPST---RIRLWICGYALQCLVHVVLVW--MEYRRR  130 (259)
Q Consensus        82 nLaqIvaAivVL~lS~~E~P~~---PLr~WIvGYa~gCv~hl~lV~--~rYr~R  130 (259)
                      .++.+++++.++-....+++..   .--..++|+.+-.+..+.+++  +||+++
T Consensus        17 ~l~l~~~g~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ry~~~   70 (73)
T PF02656_consen   17 ALALVGVGLALLRFFSLDHPSSSASRRVSKVLGLLLIVLGLLTLIYGIYRYRRR   70 (73)
T ss_pred             HHHHHHHHHHHHHhccccccccccchHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4667777777777776554421   334668898888887777776  445544


No 6  
>PF10329 DUF2417:  Region of unknown function (DUF2417);  InterPro: IPR019431  This entry represents a family of fungal proteins with no known function. In some cases these proteins also contain an alpha/beta hydrolase fold (IPR000073 from INTERPRO). 
Probab=46.13  E-value=98  Score=28.67  Aligned_cols=80  Identities=15%  Similarity=0.238  Sum_probs=43.4

Q ss_pred             hhHHHHhHHHHHHHHHHHHhhheeeeeecCccccccCchhH--H---HHHHHHhhhhHHHHHHHHHH----HHHHHHHHh
Q 025004          168 TSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLY--W---LAVVFLAFDVFFAIFCVVLA----CLIGIALCC  238 (259)
Q Consensus       168 ~~i~k~lesalt~Ff~VWfVVGf~WV~~gg~ss~~daP~LY--w---LcivFLAFd~ifvvfcyal~----cli~ialCC  238 (259)
                      -+..|-+-.++....++|||+-.+=.|..-....+..+-.+  +   ++++-+.++-+|    +++|    -++++.+|+
T Consensus        35 ir~~r~i~~~~l~i~~iw~v~llvS~F~s~Pg~~~Rg~~F~~~~l~~lsl~~~~~~L~F----f~vpS~~~r~l~~vl~~  110 (232)
T PF10329_consen   35 IRNLRWILNIFLAINFIWWVLLLVSDFFSPPGFNNRGSGFLDFDLTLLSLITNLFNLWF----FGVPSKLERILNIVLAG  110 (232)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhCCCCCCCCCCchHHHHHHHHHHHHHHHHHHh----eecCcHHHHHHHHHHHH
Confidence            35667777788888899999876644432223223333322  3   344444444443    3333    566677776


Q ss_pred             hHHHHHHHHHHhh
Q 025004          239 CLPCIIAILYAVA  251 (259)
Q Consensus       239 CLPcIIaiLyav~  251 (259)
                      ++=.=.-++++|.
T Consensus       111 Lllvdlilil~V~  123 (232)
T PF10329_consen  111 LLLVDLILILAVP  123 (232)
T ss_pred             HHHHHHHHHHhhH
Confidence            6653333344443


No 7  
>PF13748 ABC_membrane_3:  ABC transporter transmembrane region
Probab=43.47  E-value=59  Score=30.32  Aligned_cols=73  Identities=21%  Similarity=0.345  Sum_probs=53.3

Q ss_pred             HhhHhHHHH--HHHhhcCCCCCCch----hh------H-----HHHHHHHHHHHHHHHHHhccCCCCCchHHHHHHHhhh
Q 025004           52 LVRETAARE--LEERRADWGYSKPV----VA------L-----DIMWNSAFVIVSAAMLIITINERPSTRIRLWICGYAL  114 (259)
Q Consensus        52 ~vre~aa~~--le~r~~dwaySk~~----v~------L-----elvwnLaqIvaAivVL~lS~~E~P~~PLr~WIvGYa~  114 (259)
                      ++|+.-|-+  ++.|+.+-..|+.-    ++      +     .++-++++++.|+++|..         +-.|+-.=.+
T Consensus        75 rIy~~la~~vi~~qr~~~~~~S~i~ARv~lsRE~VdFfE~~lP~lits~vsivga~vmLl~---------~e~~~g~~~l  145 (237)
T PF13748_consen   75 RIYAELAVPVILSQRQQGLSVSTIAARVALSREFVDFFEQHLPTLITSVVSIVGAAVMLLV---------FEFWLGLACL  145 (237)
T ss_pred             HHHHHHhHHHHHHHHHhCCChhHHHHHHHHHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHH---------HHHHHHHHHH
Confidence            456666666  66666666555432    11      1     235789999999999975         4589988888


Q ss_pred             hHHHHHHHHHHHHHHhhcc
Q 025004          115 QCLVHVVLVWMEYRRRNTR  133 (259)
Q Consensus       115 gCv~hl~lV~~rYr~Rn~~  133 (259)
                      +=++-+.+++.+|-++|.+
T Consensus       146 ~~l~~~~~i~~~f~~~~~~  164 (237)
T PF13748_consen  146 LILALFLLILPRFARRNYR  164 (237)
T ss_pred             HHHHHHHHHHHHHHHHHHH
Confidence            8889999999999888765


No 8  
>PTZ00201 amastin surface glycoprotein; Provisional
Probab=38.86  E-value=48  Score=29.86  Aligned_cols=21  Identities=19%  Similarity=0.235  Sum_probs=13.0

Q ss_pred             HHHHHHHHHHHHHHHHhhHHH
Q 025004          222 AIFCVVLACLIGIALCCCLPC  242 (259)
Q Consensus       222 vvfcyal~cli~ialCCCLPc  242 (259)
                      .+|.|..++++|+..-||-+|
T Consensus        84 SI~v~~aA~vlg~~~l~cc~~  104 (192)
T PTZ00201         84 SILVYGAAFVLGLVLLYGCTI  104 (192)
T ss_pred             HHHHHHHHHHHHHHHHHccch
Confidence            445888888886664334333


No 9  
>PHA03283 envelope glycoprotein E; Provisional
Probab=37.89  E-value=28  Score=35.89  Aligned_cols=28  Identities=32%  Similarity=0.578  Sum_probs=19.6

Q ss_pred             HHHH-HHhhhhHHHHHHHH------HHHHHHhhcc
Q 025004          106 RLWI-CGYALQCLVHVVLV------WMEYRRRNTR  133 (259)
Q Consensus       106 r~WI-vGYa~gCv~hl~lV------~~rYr~Rn~~  133 (259)
                      +-|+ +++.++|++-+.++      |.+||++|++
T Consensus       397 ~~~l~~~~~~~~~~~~~~~~l~vw~c~~~r~~~~~  431 (542)
T PHA03283        397 RHYLAFLLAIICTCAALLVALVVWGCILYRRSNRK  431 (542)
T ss_pred             cccchhHHHHHHHHHHHHHHHhhhheeeehhhcCC
Confidence            5666 78888888665443      5677877766


No 10 
>PF11712 Vma12:  Endoplasmic reticulum-based factor for assembly of V-ATPase;  InterPro: IPR021013 ATPases (or ATP synthases) are membrane-bound enzyme complexes/ion transporters that combine ATP synthesis and/or hydrolysis with the transport of protons across a membrane. ATPases can harness the energy from a proton gradient, using the flux of ions across the membrane via the ATPase proton channel to drive the synthesis of ATP. Some ATPases work in reverse, using the energy from the hydrolysis of ATP to create a proton gradient. There are different types of ATPases, which can differ in function (ATP synthesis and/or hydrolysis), structure (e.g., F-, V- and A-ATPases, which contain rotary motors) and in the type of ions they transport [, ]. The different types include:   F-ATPases (F1F0-ATPases), which are found in mitochondria, chloroplasts and bacterial plasma membranes where they are the prime producers of ATP, using the proton gradient generated by oxidative phosphorylation (mitochondria) or photosynthesis (chloroplasts). V-ATPases (V1V0-ATPases), which are primarily found in eukaryotic vacuoles and catalyse ATP hydrolysis to transport solutes and lower pH in organelles. A-ATPases (A1A0-ATPases), which are found in Archaea and function like F-ATPases (though with respect to their structure and some inhibitor responses, A-ATPases are more closely related to the V-ATPases). P-ATPases (E1E2-ATPases), which are found in bacteria and in eukaryotic plasma membranes and organelles, and function to transport a variety of different ions across membranes. E-ATPases, which are cell-surface enzymes that hydrolyse a range of NTPs, including extracellular ATP.   V-ATPases (also known as V1V0-ATPase or vacuolar ATPase) (3.6.3.14 from EC) are found in the eukaryotic endomembrane system, and in the plasma membrane of prokaryotes and certain specialised eukaryotic cells. V-ATPases hydrolyse ATP to drive a proton pump, and are involved in a variety of vital intra- and inter-cellular processes such as receptor mediated endocytosis, protein trafficking, active transport of metabolites, homeostasis and neurotransmitter release []. V-ATPases are composed of two linked complexes: the V1 complex (subunits A-H) contains the catalytic core that hydrolyses ATP, while the V0 complex (subunits a, c, c', c'', d) forms the membrane-spanning pore. V-ATPases may have an additional role in membrane fusion through binding to t-SNARE proteins [].  The yeast vacuolar proton-translocating ATPase (V-ATPase) is the best characterised member of the V-ATPase family. A total of thirteen genes are required for encoding the subunits of the enzyme complex itself and an additional three for providing factors necessary for the assembly of the whole. Vma12 is one of these latter, all three of which are localised to the endoplasmic reticulum []. 
Probab=37.55  E-value=55  Score=27.30  Aligned_cols=27  Identities=11%  Similarity=0.203  Sum_probs=21.3

Q ss_pred             chhhHHHHhHHHHHHHHHHHHhhheee
Q 025004          166 TRTSFTKRCESINTMASFLWWIVGFYW  192 (259)
Q Consensus       166 ~~~~i~k~lesalt~Ff~VWfVVGf~W  192 (259)
                      .-+.+.+-+=++..+|+++||..+-.|
T Consensus        78 qls~v~Nilvsv~~~~~~~~~~~~~~~  104 (142)
T PF11712_consen   78 QLSTVFNILVSVFAVFFAGWYWAGYSF  104 (142)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            345778888999999999997777555


No 11 
>PF11368 DUF3169:  Protein of unknown function (DUF3169);  InterPro: IPR021509  Some members in this family of proteins are annotated as membrane proteins however this cannot be confirmed. Currently there is no known function. 
Probab=35.79  E-value=1.1e+02  Score=27.64  Aligned_cols=17  Identities=12%  Similarity=0.237  Sum_probs=10.1

Q ss_pred             ccCchhHHHHHHHHhhh
Q 025004          202 QAAPRLYWLAVVFLAFD  218 (259)
Q Consensus       202 ~daP~LYwLcivFLAFd  218 (259)
                      .+.+...|..+.|+..-
T Consensus       126 ~~~~~~l~~~i~~~v~~  142 (248)
T PF11368_consen  126 ISNKSSLFIIIPFLVLL  142 (248)
T ss_pred             cCcchHHHHHHHHHHHH
Confidence            45566677767666433


No 12 
>PF05478 Prominin:  Prominin;  InterPro: IPR008795 The prominins are an emerging family of proteins that, among the multispan membrane proteins, display a novel topology. Mouse and Homo sapiens prominin and (Mus musculus) prominin-like 1 (PROML1) are predicted to contain five membrane spanning domains, with an N-terminal domain exposed to the extracellular space followed by four, alternating small cytoplasmic and large extracellular, loops and a cytoplasmic C-terminal domain []. The exact function of prominin is unknown although in humans defects in PROM1, the gene coding for prominin, cause retinal degeneration [].; GO: 0016021 integral to membrane
Probab=34.87  E-value=44  Score=35.58  Aligned_cols=29  Identities=31%  Similarity=0.939  Sum_probs=18.6

Q ss_pred             hHHHHHHHHhhhhHHHHHHHHHHHHHHHHHHhh
Q 025004          207 LYWLAVVFLAFDVFFAIFCVVLACLIGIALCCC  239 (259)
Q Consensus       207 LYwLcivFLAFd~ifvvfcyal~cli~ialCCC  239 (259)
                      .||.-+++.++.++|+|+   || ++|+..|||
T Consensus        89 ~~~g~~v~~~i~ll~~il---~P-~vg~~fCcC  117 (806)
T PF05478_consen   89 YEWGFLVCAVIGLLFIIL---MP-LVGLCFCCC  117 (806)
T ss_pred             HHHHHHHHHHHHHHHHHH---HH-HHHHHHhcc
Confidence            467777777766665544   44 456677777


No 13 
>KOG1935 consensus Membrane protein Patched/PTCH [Signal transduction mechanisms]
Probab=33.82  E-value=40  Score=37.08  Aligned_cols=40  Identities=30%  Similarity=0.639  Sum_probs=33.3

Q ss_pred             HHHHHHHhhhhH-HHH--HHHHHHHHHHHHHH---hhHHHHHHHHH
Q 025004          209 WLAVVFLAFDVF-FAI--FCVVLACLIGIALC---CCLPCIIAILY  248 (259)
Q Consensus       209 wLcivFLAFd~i-fvv--fcyal~cli~ialC---CCLPcIIaiLy  248 (259)
                      ||-+.+|+|+-| |+|  |+++|..++|+-+|   |-||.+.++++
T Consensus      1026 ~lgv~MLs~S~FdFvVryFf~~ltvl~~lGv~ngL~~lPVlLS~~G 1071 (1143)
T KOG1935|consen 1026 LLGVLMLSFSEFDFVVRYFFAVLTVLTCLGVLNGLVVLPVLLSLVG 1071 (1143)
T ss_pred             HhhHheeccCchhHHHHHHHHHHHHHHHHHHhccchHHHHHHHhcC
Confidence            788888998888 776  88899999999887   78898887764


No 14 
>PF02985 HEAT:  HEAT repeat;  InterPro: IPR000357 The HEAT repeat is a tandemly repeated, 37-47 amino acid long module occurring in a number of cytoplasmic proteins, including the four name-giving proteins huntingtin, elongation factor 3 (EF3), the 65 Kd alpha regulatory subunit of protein phosphatase 2A (PP2A) and the yeast PI3-kinase TOR1 []. Arrays of HEAT repeats consists of 3 to 36 units forming a rod-like helical structure and appear to function as protein-protein interaction surfaces. It has been noted that many HEAT repeat-containing proteins are involved in intracellular transport processes. In the crystal structure of PP2A PR65/A [], the HEAT repeats consist of pairs of antiparallel alpha helices [].; GO: 0005515 protein binding; PDB: 3FGA_A 2PF4_C 2IAE_A 2BKU_D 3EA5_B 3ND2_A 2BPT_A 2NYL_A 2NPP_D 2PKG_B ....
Probab=28.16  E-value=32  Score=21.27  Aligned_cols=19  Identities=37%  Similarity=0.266  Sum_probs=14.7

Q ss_pred             CCCCCchHhhHhHHHHHHH
Q 025004           45 RGHGPSMLVRETAARELEE   63 (259)
Q Consensus        45 ~~r~ps~~vre~aa~~le~   63 (259)
                      ++.+|+-.||++|++-+.+
T Consensus         8 ~l~D~~~~VR~~a~~~l~~   26 (31)
T PF02985_consen    8 LLNDPSPEVRQAAAECLGA   26 (31)
T ss_dssp             HHT-SSHHHHHHHHHHHHH
T ss_pred             HcCCCCHHHHHHHHHHHHH
Confidence            3578999999999987753


No 15 
>MTH00169 ATP8 ATP synthase F0 subunit 8; Provisional
Probab=27.54  E-value=99  Score=23.35  Aligned_cols=14  Identities=7%  Similarity=0.508  Sum_probs=10.6

Q ss_pred             CchhHHHHHHHHhh
Q 025004          204 APRLYWLAVVFLAF  217 (259)
Q Consensus       204 aP~LYwLcivFLAF  217 (259)
                      .+|++|++++|.++
T Consensus        10 ~sQ~~Wl~i~f~~l   23 (67)
T MTH00169         10 LTQYIWTLIILFFL   23 (67)
T ss_pred             HHHHHHHHHHHHHH
Confidence            36889999877654


No 16 
>PF05961 Chordopox_A13L:  Chordopoxvirus A13L protein;  InterPro: IPR009236 This family consists of A13L proteins from the Chordopoxviruses. A13L or p8 is one of the three most abundant membrane proteins of the intracellular mature Vaccinia virus [].
Probab=27.30  E-value=74  Score=24.51  Aligned_cols=14  Identities=36%  Similarity=0.676  Sum_probs=9.5

Q ss_pred             hHHHHHHHHHHhhc
Q 025004          239 CLPCIIAILYAVAG  252 (259)
Q Consensus       239 CLPcIIaiLyav~~  252 (259)
                      |+-.|-.|+|++=.
T Consensus        11 CVaii~lIlY~iYn   24 (68)
T PF05961_consen   11 CVAIIGLILYGIYN   24 (68)
T ss_pred             HHHHHHHHHHHHHh
Confidence            34447788899864


No 17 
>PF12326 EOS1:  N-glycosylation protein;  InterPro: IPR021100  This entry represents a family, containing several predicted transmembrane helices, which includes the fungal N-glycosylation protein EOS1. EOS1 is not essential for cell growth, but is necessary for tolerance to oxidative stress, and appears to be involved the N-glycosylation of cellular proteins [].
Probab=26.84  E-value=2.1e+02  Score=25.01  Aligned_cols=43  Identities=14%  Similarity=0.387  Sum_probs=29.5

Q ss_pred             HHHHHHHHHhcc-CCCCCchHHHHHHHhhhhHHHHHHHHHHHHHHhh
Q 025004           86 VIVSAAMLIITI-NERPSTRIRLWICGYALQCLVHVVLVWMEYRRRN  131 (259)
Q Consensus        86 IvaAivVL~lS~-~E~P~~PLr~WIvGYa~gCv~hl~lV~~rYr~Rn  131 (259)
                      |......+.+|- .++|+.||..||+   ++|.+++.-..-.|-.-|
T Consensus        51 i~~t~~~l~ls~~s~d~~~~L~~WI~---Is~~lt~~yivq~~vTSN   94 (148)
T PF12326_consen   51 ICWTLEHLLLSGLSPDPRYPLPAWIL---ISCTLTISYIVQNWVTSN   94 (148)
T ss_pred             HHHHHHHHHHHhcCCCccccchHHHH---HHHHHHHHHHHHHHHhcc
Confidence            555666666663 4559999999996   677777776666565544


No 18 
>PHA03049 IMV membrane protein; Provisional
Probab=25.69  E-value=82  Score=24.23  Aligned_cols=12  Identities=25%  Similarity=0.301  Sum_probs=8.2

Q ss_pred             HHHHHHHHHhhc
Q 025004          241 PCIIAILYAVAG  252 (259)
Q Consensus       241 PcIIaiLyav~~  252 (259)
                      -.|-.|+|++=.
T Consensus        13 aIi~lIvYgiYn   24 (68)
T PHA03049         13 VIIGLIVYGIYN   24 (68)
T ss_pred             HHHHHHHHHHHh
Confidence            337777888864


No 19 
>smart00714 LITAF Possible membrane-associated motif in LPS-induced tumor necrosis factor alpha factor (LITAF), also known as PIG7, and other animal proteins.
Probab=25.54  E-value=69  Score=23.28  Aligned_cols=9  Identities=67%  Similarity=2.265  Sum_probs=6.0

Q ss_pred             HHhhHHHHH
Q 025004          236 LCCCLPCII  244 (259)
Q Consensus       236 lCCCLPcII  244 (259)
                      .|||+|+.+
T Consensus        37 ~~~~iP~~~   45 (67)
T smart00714       37 FCCCLPCCL   45 (67)
T ss_pred             HHHHHHHhc
Confidence            477888644


No 20 
>PF01534 Frizzled:  Frizzled/Smoothened family membrane region;  InterPro: IPR000539 The frizzled (fz) locus of Drosophila coordinates the cytoskeletons of epidermal cells, producing a parallel array of cuticular hairs and bristles [, ]. In fz mutants, the orientation of individual hairs with respect both to their neighbours and to the organism as a whole is altered. In the wild-type wing, all hairs point towards the distal tip []. In the developing wing, fz has 2 functions: it is required for the proximal-distal transmission of an intracellular polarity signal; and it is required for cells to respond to the polarity signal. Fz produces an mRNA that encodes an integral membrane protein with 7 putative transmembrane (TM) domains. This protein should contain both extracellular and cytoplasmic domains, which could function in the transmission and interpretation of polarity information []. This signature is usually found downstream of the Fz domain (IPR000024 from INTERPRO); GO: 0007166 cell surface receptor linked signaling pathway, 0016020 membrane
Probab=25.35  E-value=3.2e+02  Score=26.29  Aligned_cols=29  Identities=28%  Similarity=0.482  Sum_probs=19.6

Q ss_pred             HHHHhHHHHHHHHHHHHhhhee-eeeecCc
Q 025004          170 FTKRCESINTMASFLWWIVGFY-WVVSGGD  198 (259)
Q Consensus       170 i~k~lesalt~Ff~VWfVVGf~-WV~~gg~  198 (259)
                      ++--+-....|-+.+|||+-.+ |..+.|.
T Consensus        96 ~~F~l~Yyf~mAa~~WWviLt~~W~lsa~~  125 (328)
T PF01534_consen   96 VVFLLLYYFGMAASLWWVILTLTWFLSAGL  125 (328)
T ss_pred             hHHHHHHHHHhHHHHHHHHHHHHHHHHhhc
Confidence            3334555556667899998776 8876654


No 21 
>TIGR02741 TraQ type-F conjugative transfer system pilin chaperone TraQ. This protein makes a specific interaction with the pilin (TraA) protein to aid its transfer through the inner membrane during the process of F-type conjugative pilus assembly.
Probab=25.21  E-value=64  Score=25.38  Aligned_cols=22  Identities=27%  Similarity=0.259  Sum_probs=16.1

Q ss_pred             CCCCchhhHHHHHHHHHHHHHHHHHH
Q 025004           69 GYSKPVVALDIMWNSAFVIVSAAMLI   94 (259)
Q Consensus        69 aySk~~v~LelvwnLaqIvaAivVL~   94 (259)
                      -|++||+    .|-+++|++.+.||.
T Consensus        32 Vy~~P~m----A~~laeliav~lVl~   53 (80)
T TIGR02741        32 VYRKPWM----AFFLAELIAVILVLW   53 (80)
T ss_pred             HHcChHH----HHHHHHHHHHHHHHh
Confidence            3778875    467888888777765


No 22 
>PF01036 Bac_rhodopsin:  Bacteriorhodopsin-like protein;  InterPro: IPR001425 The bacterial opsins are retinal-binding proteins that provide light- dependent ion transport and sensory functions to a family of halophilic bacteria [, ]. They are integral membrane proteins believed to contain seven transmembrane (TM) domains, the last of which contains the attachment point for retinal (a conserved lysine). There are several classes of these bacterial proteins: they include bacteriorhodopsin and archaerhodopsin, which are light-driven proton pumps; halorhodopsin, a light-driven chloride pump; and sensory rhodopsin, which mediates both photoattractant (in the red) and photophobic (in the UV) responses.; GO: 0005216 ion channel activity, 0006811 ion transport, 0016020 membrane; PDB: 3QBI_B 3QBK_D 3QBL_D 3QBG_B 3AM6_D 1UAZ_B 1E12_A 2JAF_A 2JAG_A 3UG9_A ....
Probab=24.29  E-value=2.7e+02  Score=24.57  Aligned_cols=126  Identities=17%  Similarity=0.366  Sum_probs=67.0

Q ss_pred             HhhcCCCCCCchhhHHHH-------HHHH-HHHHHHHHHHhc-cCC-CCCchHHHHHHHhhhhHHHHHHHHHHHHHHhhc
Q 025004           63 ERRADWGYSKPVVALDIM-------WNSA-FVIVSAAMLIIT-INE-RPSTRIRLWICGYALQCLVHVVLVWMEYRRRNT  132 (259)
Q Consensus        63 ~r~~dwaySk~~v~Lelv-------wnLa-qIvaAivVL~lS-~~E-~P~~PLr~WIvGYa~gCv~hl~lV~~rYr~Rn~  132 (259)
                      -|--||.-.-|.+.+++.       .++. .|.+..++++.. -.| -+..  .-| ..|+++|++.+.++|.-+..-++
T Consensus        72 ~RYidW~lT~Plll~~L~~lag~~~~~~~~~i~~~~~mi~~g~~g~~~~~~--~kw-~~~~~~~~~~~~i~y~l~~~~~~  148 (222)
T PF01036_consen   72 ARYIDWLLTTPLLLLALALLAGASRRLLLFLIAADVVMIVTGLVGALVPGT--YKW-GWFLVSCAAFLYIVYLLFGPLRR  148 (222)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCTTTHHHHHHHHHHHHHHHHHHHHHHHTSHH--HHH-HHHHHHHHHHHHHHHHHHTHHHH
T ss_pred             HHHhhHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHhcccH--HHH-HHHHHHHHHHHHHHHHHHHHHHH
Confidence            577788877788766653       2222 222333322222 111 1222  244 67899999999998876643322


Q ss_pred             ccCCCccCCCCCCCCCCCCCCccccccccccccchhhHHHHhHHHHHHHHHHHHhhheeeeeecCccccccCchhHHHHH
Q 025004          133 RRVRDDEMGGEDFRDVNNDSEDEEEDGIVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAV  212 (259)
Q Consensus       133 ~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~~~~~~~~i~k~lesalt~Ff~VWfVVGf~WV~~gg~ss~~daP~LYwLci  212 (259)
                      ...+                             .+.+. +..+..-.+..++|.+-..+|..+.+.... | |  .---+
T Consensus       149 ~a~~-----------------------------~~~~~-~~~~~l~~~~~~~W~~YPi~w~l~~~g~~i-~-~--~~~~i  194 (222)
T PF01036_consen  149 AASA-----------------------------VSPSV-GLYNKLRNLTVVLWILYPIVWLLSEGGNGI-D-P--TVEAI  194 (222)
T ss_dssp             HHTT-----------------------------STHHH-HHHHHHHHHHHHHHHHHHHHHHHSTTTTSS-C-H--HHHHH
T ss_pred             HHHh-----------------------------cCchH-HHHHHHHHHHHHHHHHHHHHHHHhcCCCcC-C-c--hHHHH
Confidence            2100                             01222 444555557788899999999985332222 2 2  12344


Q ss_pred             HHHhhhhH-HHHHH
Q 025004          213 VFLAFDVF-FAIFC  225 (259)
Q Consensus       213 vFLAFd~i-fvvfc  225 (259)
                      .|--.|++ .++|+
T Consensus       195 ~y~ilD~~~K~~fg  208 (222)
T PF01036_consen  195 FYGILDLLAKVGFG  208 (222)
T ss_dssp             HHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHH
Confidence            55555655 34443


No 23 
>PF10601 zf-LITAF-like:  LITAF-like zinc ribbon domain;  InterPro: IPR006629 Members of this family display a conserved zinc ribbon structure [] with the motif C-XX-C- separated from the more C-terminal HX-C(P)X-C-X4-G-R motif by a variable region of usually 25-30 (hydrophobic) residues. Although it belongs to one of the zinc finger's fold groups (zinc ribbon), this particular domain was first identified in LPS-induced tumour necrosis alpha factor (LITAF) which is produced in mammalian cells after being challenged with lipopolysaccharide (LPS). The hydrophobic region probably inserts into the membrane rather than traversing it. Such an insertion brings together the N- and C-terminal C-XX-C motifs to form a compact Zn2+-binding structure []. 
Probab=24.10  E-value=89  Score=23.04  Aligned_cols=15  Identities=47%  Similarity=1.287  Sum_probs=9.2

Q ss_pred             HHHHHHHHhhHHHHH
Q 025004          230 CLIGIALCCCLPCII  244 (259)
Q Consensus       230 cli~ialCCCLPcII  244 (259)
                      |+++...|||+|+.+
T Consensus        37 ~~~~~~~~~~iP~~~   51 (73)
T PF10601_consen   37 CLFGCWPCCCIPFCC   51 (73)
T ss_pred             HHHHHHHHhhHhhcc
Confidence            444445568888765


No 24 
>PF06814 Lung_7-TM_R:  Lung seven transmembrane receptor;  InterPro: IPR009637 This family represents a conserved region with eukaryotic lung seven transmembrane receptors and related proteins.; GO: 0016021 integral to membrane
Probab=22.87  E-value=5.9e+02  Score=23.30  Aligned_cols=122  Identities=11%  Similarity=0.208  Sum_probs=78.9

Q ss_pred             CchhhHHHHHHHHHHHHHHHHHHhc-cCCCCCchHHHHHHHhhhhHHHHHHHHHHHHHHhhcccCCCccCCCCCCCCCCC
Q 025004           72 KPVVALDIMWNSAFVIVSAAMLIIT-INERPSTRIRLWICGYALQCLVHVVLVWMEYRRRNTRRVRDDEMGGEDFRDVNN  150 (259)
Q Consensus        72 k~~v~LelvwnLaqIvaAivVL~lS-~~E~P~~PLr~WIvGYa~gCv~hl~lV~~rYr~Rn~~~~~~~~~~~~~~~~~~~  150 (259)
                      .|-..+-.+..++..+.++.-+... |+-+--.|+.-||.+..+=..+.+.+.+..|...|....+.             
T Consensus        45 ~pl~~~y~~~~i~y~~~~~~W~~~~~~~~~~~~~ih~~i~~vl~l~~~~~~~~~~~y~~~n~~G~~~-------------  111 (295)
T PF06814_consen   45 YPLPPFYGVMSIVYAVLLIIWLFLCFKNRKSVLPIHYLILAVLILKMLELAFWFIYYHYINKTGTPS-------------  111 (295)
T ss_pred             cccHHHHHHHHHHHHHHHHHHHHHHHHHhcchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHcCCCCC-------------
Confidence            4556677778888888877777766 45566789999999999999999999999998888753210             


Q ss_pred             CCCccccccccccccchhhHHHHhHHHHHHHHHHHHhhheeeeeecCccccccCchhHHHHHHHHhhhhH
Q 025004          151 DSEDEEEDGIVYRTSTRTSFTKRCESINTMASFLWWIVGFYWVVSGGDLLLQAAPRLYWLAVVFLAFDVF  220 (259)
Q Consensus       151 ~~~~~~~e~~~~~~~~~~~i~k~lesalt~Ff~VWfVVGf~WV~~gg~ss~~daP~LYwLcivFLAFd~i  220 (259)
                             +..    .--..+.+.+|.  ++++++=.++|--|-+. ...+.+.--+...+-+.+..++.+
T Consensus       112 -------~~~----~~~~~i~~~~k~--~~~~~llllis~Gygiv-kp~L~~~~~~v~~l~i~~~v~~~i  167 (295)
T PF06814_consen  112 -------EGW----MIFAYIFSALKR--TLSFFLLLLISLGYGIV-KPSLGRREKKVLMLVILYFVFSNI  167 (295)
T ss_pred             -------chH----HHHHHHHHHHHH--HHHHHHHHHHhcchhee-ccccCcceeehhHHHHHHHHHHHH
Confidence                   000    012455666664  44555566777778773 444433333444555555555554


No 25 
>PF02932 Neur_chan_memb:  Neurotransmitter-gated ion-channel transmembrane region ion channel family signature gamma-aminobutyric acid (GABA) receptor signature nicotinic acetylcholine receptor signature;  InterPro: IPR006029 Neurotransmitter ligand-gated ion channels are transmembrane receptor-ion channel complexes that open transiently upon binding of specific ligands, allowing rapid transmission of signals at chemical synapses [, ]. Five of these ion channel receptor families have been shown to form a sequence-related superfamily:   Nicotinic acetylcholine receptor (AchR), an excitatory cation channel in vertebrates and invertebrates; in vertebrate motor endplates it is composed of alpha, beta, gamma and delta/epsilon subunits; in neurons it is composed of alpha and non-alpha (or beta) subunits []. Glycine receptor, an inhibitory chloride ion channel composed of alpha and beta subunits []. Gamma-aminobutyric acid (GABA) receptor, an inhibitory chloride ion channel; at least four types of subunits (alpha, beta, gamma and delta) are known []. Serotonin 5HT3 receptor, of which there are seven major types (5HT3-5HT7) []. Glutamate receptor, an excitatory cation channel of which at least three types have been described (kainate, N-methyl-D-aspartate (NMDA) and quisqualate) [].   These receptors possess a pentameric structure (made up of varying subunits), surrounding a central pore. All known sequences of subunits from neurotransmitter-gated ion-channels are structurally related. They are composed of a large extracellular glycosylated N-terminal ligand-binding domain, followed by three hydrophobic transmembrane regions which form the ionic channel, followed by an intracellular region of variable length. A fourth hydrophobic region is found at the C-terminal of the sequence [, ]. This domain represents four transmembrane helices of a variety of neurotransmitter-gated ion-channels.; GO: 0006811 ion transport, 0016020 membrane; PDB: 1DXZ_A 3MRA_A 1EQ8_C 1OED_C 2PR9_P 1A11_A 1CEK_A 2BG9_E 2KSR_A 2K59_B ....
Probab=22.50  E-value=2.4e+02  Score=22.12  Aligned_cols=12  Identities=33%  Similarity=0.661  Sum_probs=7.7

Q ss_pred             HHHhhhhHHHHH
Q 025004          213 VFLAFDVFFAIF  224 (259)
Q Consensus       213 vFLAFd~ifvvf  224 (259)
                      ++||+.+++-+.
T Consensus        33 ~lL~~~~~~~~~   44 (237)
T PF02932_consen   33 TLLAMTVFLLMV   44 (237)
T ss_dssp             HHHHHHHHHHHH
T ss_pred             HHHHHHHHHhhh
Confidence            477777775444


No 26 
>PF02411 MerT:  MerT mercuric transport protein;  InterPro: IPR003457 MerT is an mercuric transport integral membrane protein and is responsible for transport of the Hg2+ iron from periplasmic MerP (also part of the transport system) to mercuric reductase (MerA).; GO: 0015097 mercury ion transmembrane transporter activity, 0015694 mercury ion transport, 0016020 membrane
Probab=22.32  E-value=80  Score=26.18  Aligned_cols=18  Identities=28%  Similarity=0.519  Sum_probs=14.1

Q ss_pred             HHHHHHHhhHHHHHHHHH
Q 025004          231 LIGIALCCCLPCIIAILY  248 (259)
Q Consensus       231 li~ialCCCLPcIIaiLy  248 (259)
                      -++++.||-+|.+...++
T Consensus        18 Av~aS~CCi~Pllll~lG   35 (116)
T PF02411_consen   18 AVLASLCCIGPLLLLSLG   35 (116)
T ss_pred             HHHHHHHHHHHHHHHHHh
Confidence            457889999997776664


No 27 
>PF09125 COX2-transmemb:  Cytochrome C oxidase subunit II, transmembrane;  InterPro: IPR015209 This N-terminal domain forms the transmembrane region in subunit II of cytochrome c oxidase from Thermus thermophilus. This domain adopts a tertiary structure consisting of two antiparallel transmembrane helices, in a transmembrane helix hairpin fold []. ; PDB: 1EHK_B 2QPE_B 3S8F_B 4EV3_B 3BVD_B 3S8G_B 3EH3_B 3S3C_B 3S39_B 3QJQ_B ....
Probab=22.11  E-value=51  Score=22.65  Aligned_cols=22  Identities=14%  Similarity=0.309  Sum_probs=17.3

Q ss_pred             CCCCchhhHHHHHHHHHHHHHH
Q 025004           69 GYSKPVVALDIMWNSAFVIVSA   90 (259)
Q Consensus        69 aySk~~v~LelvwnLaqIvaAi   90 (259)
                      +|.|-|+..-++.-++||+...
T Consensus        11 aYEr~Wi~F~l~mi~vFi~li~   32 (38)
T PF09125_consen   11 AYERGWIAFALAMILVFIALIG   32 (38)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHhHHHHHHHHHHHHHHHHH
Confidence            4889999988888888876443


No 28 
>PF08370 PDR_assoc:  Plant PDR ABC transporter associated;  InterPro: IPR013581 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems. ABC transporters minimally consist of two conserved regions: a highly conserved ATP binding cassette (ABC) and a less conserved transmembrane domain (TMD). These can be found on the same protein or on two different ones. Most ABC transporters function as a dimer and therefore are constituted of four domains, two ABC modules and two TMDs. ABC transporters are involved in the export or import of a wide variety of substrates ranging from small ions to macromolecules. The major function of ABC import systems is to provide essential nutrients to bacteria. They are found only in prokaryotes and their four constitutive domains are usually encoded by independent polypeptides (two ABC proteins and two TMD proteins). Prokaryotic importers require additional extracytoplasmic binding proteins (one or more per systems) for function. In contrast, export systems are involved in the extrusion of noxious substances, the export of extracellular toxins and the targeting of membrane components. They are found in all living organisms and in general the TMD is fused to the ABC module in a variety of combinations. Some eukaryotic exporters encode the four domains on the same polypeptide chain [].  The ABC module (approximately two hundred amino acid residues) is known to bind and hydrolyse ATP, thereby coupling transport to ATP hydrolysis in a large number of biological processes. The cassette is duplicated in several subfamilies. Its primary sequence is highly conserved, displaying a typical phosphate-binding loop: Walker A, and a magnesium binding site: Walker B. Besides these two regions, three other conserved motifs are present in the ABC cassette: the switch region which contains a histidine loop, postulated to polarise the attaching water molecule for hydrolysis, the signature conserved motif (LSGGQ) specific to the ABC transporter, and the Q-motif (between Walker A and the signature), which interacts with the gamma phosphate through a water bond. The Walker A, Walker B, Q-loop and switch region form the nucleotide binding site [, , ]. The 3D structure of a monomeric ABC module adopts a stubby L-shape with two distinct arms. ArmI (mainly beta-strand) contains Walker A and Walker B. The important residues for ATP hydrolysis and/or binding are located in the P-loop. The ATP-binding pocket is located at the extremity of armI. The perpendicular armII contains mostly the alpha helical subdomain with the signature motif. It only seems to be required for structural integrity of the ABC module. ArmII is in direct contact with the TMD. The hinge between armI and armII contains both the histidine loop and the Q-loop, making contact with the gamma phosphate of the ATP molecule. ATP hydrolysis leads to a conformational change that could facilitate ADP release. In the dimer the two ABC cassettes contact each other through hydrophobic interactions at the antiparallel beta-sheet of armI by a two-fold axis [, , , , , ]. The ATP-Binding Cassette (ABC) superfamily forms one of the largest of all protein families with a diversity of physiological functions []. Several studies have shown that there is a correlation between the functional characterisation and the phylogenetic classification of the ABC cassette [, ]. More than 50 subfamilies have been described based on a phylogenetic and functional classification [, , ]; (for further information see http://www.tcdb.org/tcdb/index.php?tc=3.A.1). This domain is found on the C terminus of ABC-2 type transporter domains (IPR013525 from INTERPRO). It seems to be associated with the plant pleiotropic drug resistance (PDR) protein family of ABC transporters. Like in yeast, plant PDR ABC transporters may also play a role in the transport of antifungal agents [] (see also IPR010929 from INTERPRO). The PDR family is characterised by a configuration in which the ABC domain is nearer the N terminus of the protein than the transmembrane domain []. 
Probab=21.69  E-value=66  Score=24.24  Aligned_cols=16  Identities=44%  Similarity=0.937  Sum_probs=9.5

Q ss_pred             hhHHHHHH-HHhhhhHH
Q 025004          206 RLYWLAVV-FLAFDVFF  221 (259)
Q Consensus       206 ~LYwLciv-FLAFd~if  221 (259)
                      .-||.++. .++|.++|
T Consensus        27 ~WyWIgvgaL~G~~vlF   43 (65)
T PF08370_consen   27 YWYWIGVGALLGFIVLF   43 (65)
T ss_pred             cEEeehHHHHHHHHHHH
Confidence            45677765 44555555


No 29 
>PRK14010 potassium-transporting ATPase subunit B; Provisional
Probab=21.46  E-value=2e+02  Score=30.45  Aligned_cols=41  Identities=27%  Similarity=0.425  Sum_probs=22.2

Q ss_pred             HHHHHHHHhhhhHHHHH------HHHHHHHHHHHHHhhHHHHHHHHHH
Q 025004          208 YWLAVVFLAFDVFFAIF------CVVLACLIGIALCCCLPCIIAILYA  249 (259)
Q Consensus       208 YwLcivFLAFd~ifvvf------cyal~cli~ialCCCLPcIIaiLya  249 (259)
                      +.++++||++-+++..+      ...+.+++.+++|.| ||-+..+..
T Consensus       223 ~~l~ii~l~~~~~~~~~~~~~~~~~~~~~~val~V~~I-P~aL~~~~~  269 (673)
T PRK14010        223 MTLTIIFLVVILTMYPLAKFLNFNLSIAMLIALAVCLI-PTTIGGLLS  269 (673)
T ss_pred             HHHhHHHHHHHHHHHHHHhhccHHHHHHHHHHHHHHhh-hhhHHHHHH
Confidence            45666666654432111      123456666667765 997655443


No 30 
>PRK14749 hypothetical protein; Provisional
Probab=20.54  E-value=1.7e+02  Score=19.19  Aligned_cols=23  Identities=43%  Similarity=0.982  Sum_probs=16.7

Q ss_pred             HHHHHHhhhhHHHHH-HHHHHHHH
Q 025004          106 RLWICGYALQCLVHV-VLVWMEYR  128 (259)
Q Consensus       106 r~WIvGYa~gCv~hl-~lV~~rYr  128 (259)
                      +.||.|-.+.|...+ -.++.|.+
T Consensus         4 faWiLG~~lAc~f~ilna~w~E~~   27 (30)
T PRK14749          4 LLWFVGILLMCSLSTLVLVWLDPR   27 (30)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHH
Confidence            789999999998544 45555533


Done!