BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025008
(259 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2FUG|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus
pdb|2FUG|F Chain F, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus
pdb|2FUG|O Chain O, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus
pdb|2FUG|X Chain X, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus
pdb|3I9V|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Oxidized, 2 MolASU
pdb|3I9V|F Chain F, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Oxidized, 2 MolASU
pdb|3IAM|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Reduced, 2 MolASU, WITH BOUND NADH
pdb|3IAM|F Chain F, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Reduced, 2 MolASU, WITH BOUND NADH
pdb|3IAS|6 Chain 6, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Oxidized, 4 MolASU, RE-Refined To 3.15 Angstrom
Resolution
pdb|3IAS|F Chain F, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Oxidized, 4 MolASU, RE-Refined To 3.15 Angstrom
Resolution
pdb|3IAS|O Chain O, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Oxidized, 4 MolASU, RE-Refined To 3.15 Angstrom
Resolution
pdb|3IAS|X Chain X, Crystal Structure Of The Hydrophilic Domain Of
Respiratory Complex I From Thermus Thermophilus,
Oxidized, 4 MolASU, RE-Refined To 3.15 Angstrom
Resolution
pdb|3M9S|6 Chain 6, Crystal Structure Of Respiratory Complex I From Thermus
Thermophilus
pdb|3M9S|F Chain F, Crystal Structure Of Respiratory Complex I From Thermus
Thermophilus
pdb|2YBB|6 Chain 6, Fitted Model For Bovine Mitochondrial Supercomplex
I1iii2iv1 By Single Particle Cryo-Em (Emd-1876)
pdb|4HEA|6 Chain 6, Crystal Structure Of The Entire Respiratory Complex I
From Thermus Thermophilus
pdb|4HEA|G Chain G, Crystal Structure Of The Entire Respiratory Complex I
From Thermus Thermophilus
Length = 181
Score = 28.1 bits (61), Expect = 4.5, Method: Compositional matrix adjust.
Identities = 12/42 (28%), Positives = 20/42 (47%)
Query: 16 KGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQTDPKN 57
+G+ F +K V S +W T CC +++ TD +N
Sbjct: 17 EGILFTTLEKLVAWGRSNSLWPATFGLACCAIEMMASTDARN 58
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.317 0.130 0.375
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,069,615
Number of Sequences: 62578
Number of extensions: 216060
Number of successful extensions: 536
Number of sequences better than 100.0: 6
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 5
Number of HSP's that attempted gapping in prelim test: 535
Number of HSP's gapped (non-prelim): 6
length of query: 259
length of database: 14,973,337
effective HSP length: 97
effective length of query: 162
effective length of database: 8,903,271
effective search space: 1442329902
effective search space used: 1442329902
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)