Query         025008
Match_columns 259
No_of_seqs    168 out of 374
Neff          5.0 
Searched_HMMs 46136
Date          Fri Mar 29 09:12:50 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025008.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025008hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG2990 C2C2-type Zn-finger pr 100.0 2.7E-71 5.8E-76  504.1  12.4  253    1-257    49-308 (317)
  2 PF04502 DUF572:  Family of unk 100.0 2.3E-57 5.1E-62  423.8  14.7  175    1-178    37-214 (324)
  3 KOG2989 Uncharacterized conser 100.0 9.4E-35   2E-39  260.3   7.6  128    1-131    37-166 (253)
  4 COG5134 Uncharacterized conser 100.0 3.2E-34 6.8E-39  253.9  10.3  168    1-170    39-212 (272)
  5 PF05907 DUF866:  Eukaryotic pr  90.4    0.26 5.7E-06   42.5   3.1   62    2-65     28-91  (161)
  6 PF10122 Mu-like_Com:  Mu-like   88.8    0.43 9.4E-06   34.1   2.7   37    1-52      1-37  (51)
  7 PF08271 TF_Zn_Ribbon:  TFIIB z  88.3     0.3 6.5E-06   32.9   1.6   24   40-64      1-24  (43)
  8 smart00834 CxxC_CXXC_SSSS Puta  82.2     1.1 2.5E-05   29.0   2.1   21   33-55      1-21  (41)
  9 PRK03681 hypA hydrogenase nick  82.1    0.69 1.5E-05   37.6   1.2   30    1-48     67-96  (114)
 10 COG0375 HybF Zn finger protein  79.7     1.6 3.5E-05   36.1   2.6   27    2-47     68-94  (115)
 11 PF13240 zinc_ribbon_2:  zinc-r  78.2       1 2.2E-05   26.9   0.8   15    6-20      1-15  (23)
 12 PRK12380 hydrogenase nickel in  77.2     1.2 2.6E-05   36.2   1.2   12    1-12     67-78  (113)
 13 PRK00564 hypA hydrogenase nick  76.2     1.3 2.9E-05   36.1   1.2   29    2-48     69-97  (117)
 14 TIGR02605 CxxC_CxxC_SSSS putat  74.8     2.3   5E-05   29.3   1.9   18   33-52      1-18  (52)
 15 PF09855 DUF2082:  Nucleic-acid  69.9     4.5 9.7E-05   30.1   2.6   47    6-52      2-49  (64)
 16 TIGR00100 hypA hydrogenase nic  66.8     3.2 6.9E-05   33.7   1.4   28    2-48     68-95  (115)
 17 COG4332 Uncharacterized protei  64.7     3.3 7.2E-05   37.0   1.2   39    4-49     17-59  (203)
 18 PF07754 DUF1610:  Domain of un  62.6     6.2 0.00013   24.1   1.7   11    7-17      1-11  (24)
 19 PRK03824 hypA hydrogenase nick  62.2     4.4 9.5E-05   33.9   1.4   43    2-48     68-116 (135)
 20 COG2888 Predicted Zn-ribbon RN  61.2     7.1 0.00015   28.9   2.2   32    4-52      9-40  (61)
 21 PRK04016 DNA-directed RNA poly  57.7     5.4 0.00012   29.6   1.1   16    1-16      1-16  (62)
 22 PF05876 Terminase_GpA:  Phage   57.2     6.2 0.00014   40.2   1.8   36   29-64    190-234 (557)
 23 PRK00762 hypA hydrogenase nick  56.6       5 0.00011   33.0   0.9   12    1-13     67-78  (124)
 24 PF01921 tRNA-synt_1f:  tRNA sy  56.3     6.7 0.00015   38.2   1.8   41    1-52    171-212 (360)
 25 COG1644 RPB10 DNA-directed RNA  54.9     5.7 0.00012   29.6   0.8   24    1-26      1-24  (63)
 26 PF04502 DUF572:  Family of unk  53.2     7.1 0.00015   37.1   1.4   20   32-51     29-52  (324)
 27 PRK14890 putative Zn-ribbon RN  52.7      16 0.00035   26.9   2.8   18    3-20      6-26  (59)
 28 PF11931 DUF3449:  Domain of un  52.2     4.7  0.0001   36.2   0.0   32    6-43    103-134 (196)
 29 cd02340 ZZ_NBR1_like Zinc fing  52.1     6.9 0.00015   26.6   0.8   17    5-22      1-17  (43)
 30 PRK00398 rpoP DNA-directed RNA  51.9      13 0.00028   25.2   2.1   18   39-56     21-38  (46)
 31 PRK00750 lysK lysyl-tRNA synth  51.6      11 0.00023   38.1   2.4   39    1-51    172-211 (510)
 32 PF13005 zf-IS66:  zinc-finger   51.5      26 0.00056   23.4   3.6   41    6-46      4-47  (47)
 33 KOG2407 GPI transamidase compl  50.4       6 0.00013   40.3   0.4   12    1-12    495-506 (575)
 34 KOG3368 Transport protein part  49.1      23 0.00051   30.2   3.7   32   29-60     62-93  (140)
 35 PF01155 HypA:  Hydrogenase exp  48.0     8.8 0.00019   31.0   0.9   11    2-12     68-78  (113)
 36 PF05876 Terminase_GpA:  Phage   47.6     9.1  0.0002   39.0   1.2   39    3-50    199-240 (557)
 37 PLN00032 DNA-directed RNA poly  47.5      10 0.00022   29.0   1.1   15    1-15      1-15  (71)
 38 PF05973 Gp49:  Phage derived p  47.5      35 0.00075   25.8   4.2   46   29-75     34-80  (91)
 39 COG1405 SUA7 Transcription ini  45.9      11 0.00023   35.6   1.3   26   40-66      2-27  (285)
 40 PF01194 RNA_pol_N:  RNA polyme  43.2      10 0.00022   28.0   0.6   15    1-15      1-15  (60)
 41 TIGR02098 MJ0042_CXXC MJ0042 f  42.6      13 0.00029   23.9   1.0   18   39-56      2-19  (38)
 42 TIGR01206 lysW lysine biosynth  42.3      18 0.00039   26.0   1.7   12   41-52      4-15  (54)
 43 PF01396 zf-C4_Topoisom:  Topoi  42.3      23 0.00049   23.5   2.1   18   40-57      2-19  (39)
 44 TIGR00467 lysS_arch lysyl-tRNA  39.7      24 0.00052   35.9   2.8   38    1-51    165-202 (515)
 45 PF13248 zf-ribbon_3:  zinc-rib  39.6      15 0.00032   22.2   0.8   17    4-20      2-18  (26)
 46 PF14255 Cys_rich_CPXG:  Cystei  39.1      27 0.00058   24.9   2.2   24   41-64      2-25  (52)
 47 PRK09628 oorB 2-oxoglutarate-a  38.4      14 0.00031   34.5   0.9   19    4-22     16-34  (277)
 48 PF09723 Zn-ribbon_8:  Zinc rib  37.7      31 0.00066   23.1   2.2   19   33-53      1-19  (42)
 49 smart00659 RPOLCX RNA polymera  37.3      31 0.00067   23.6   2.2   19   38-56     18-36  (44)
 50 PHA02998 RNA polymerase subuni  36.9      22 0.00047   31.9   1.7   54   14-67    115-179 (195)
 51 PF02150 RNA_POL_M_15KD:  RNA p  36.9      34 0.00073   22.2   2.2   16   42-57      4-19  (35)
 52 cd02338 ZZ_PCMF_like Zinc fing  35.6      16 0.00034   25.4   0.5   13   34-46     10-22  (49)
 53 cd02339 ZZ_Mind_bomb Zinc fing  35.2      18 0.00039   24.9   0.8   17    5-21      1-17  (45)
 54 PF14205 Cys_rich_KTR:  Cystein  35.2      39 0.00084   24.6   2.5   38    5-53      5-42  (55)
 55 PF10058 DUF2296:  Predicted in  34.9      31 0.00067   24.7   2.0   34    2-48     20-53  (54)
 56 PF06107 DUF951:  Bacterial pro  34.9      34 0.00073   25.1   2.2   14   38-51     30-43  (57)
 57 PF06750 DiS_P_DiS:  Bacterial   34.5     6.7 0.00015   30.8  -1.6   33    6-51     35-70  (92)
 58 COG4416 Com Mu-like prophage p  34.2      25 0.00053   25.8   1.4   44    2-62      2-47  (60)
 59 PRK05778 2-oxoglutarate ferred  34.1      15 0.00033   34.7   0.4   13    4-16     18-30  (301)
 60 KOG2846 Predicted membrane pro  33.4      21 0.00046   34.4   1.2   42    3-57    219-260 (328)
 61 COG2093 DNA-directed RNA polym  32.7      24 0.00051   26.4   1.1   19   42-60     21-47  (64)
 62 PF00569 ZZ:  Zinc finger, ZZ t  32.2      22 0.00048   24.2   0.8   20    3-22      3-22  (46)
 63 cd00674 LysRS_core_class_I cat  32.0      36 0.00078   33.0   2.5   38    1-51    166-204 (353)
 64 COG1996 RPC10 DNA-directed RNA  31.7      42 0.00092   23.8   2.2   19   39-57     24-42  (49)
 65 COG2816 NPY1 NTP pyrophosphohy  31.3      32  0.0007   32.5   2.0   33   38-70    128-166 (279)
 66 PF01485 IBR:  IBR domain;  Int  31.2      28 0.00061   23.9   1.3   18    5-22     19-38  (64)
 67 PF04606 Ogr_Delta:  Ogr/Delta-  30.4      30 0.00065   23.7   1.2   19   41-59      1-19  (47)
 68 PF05864 Chordopox_RPO7:  Chord  30.2      23 0.00051   26.2   0.7   15    1-15      1-15  (63)
 69 smart00661 RPOL9 RNA polymeras  29.7      31 0.00068   23.3   1.3   10    6-15      2-11  (52)
 70 PRK11869 2-oxoacid ferredoxin   28.7      20 0.00044   33.6   0.2   11    4-14      8-18  (280)
 71 COG0484 DnaJ DnaJ-class molecu  28.7      76  0.0016   31.2   4.1   53    2-57    140-201 (371)
 72 PRK09678 DNA-binding transcrip  28.5      29 0.00062   26.4   1.0   16   40-55      2-17  (72)
 73 COG5134 Uncharacterized conser  28.0      22 0.00048   32.8   0.4   13   38-50     41-53  (272)
 74 PF05207 zf-CSL:  CSL zinc fing  27.7      52  0.0011   23.4   2.1   15   37-52     16-30  (55)
 75 PF01258 zf-dskA_traR:  Prokary  27.3      30 0.00065   22.2   0.8   14    3-17      3-16  (36)
 76 COG0846 SIR2 NAD-dependent pro  26.7      30 0.00065   32.0   0.9   16    3-18    121-136 (250)
 77 TIGR02177 PorB_KorB 2-oxoacid:  26.5      25 0.00054   33.1   0.4   11    4-14      1-11  (287)
 78 PF02146 SIR2:  Sir2 family;  I  26.3      29 0.00063   29.5   0.7   12    3-14    104-115 (178)
 79 PHA03082 DNA-dependent RNA pol  26.1      30 0.00065   25.6   0.7   15    1-15      1-15  (63)
 80 cd02344 ZZ_HERC2 Zinc finger,   26.1      32  0.0007   23.8   0.8   16    5-20      1-16  (45)
 81 COG1779 C4-type Zn-finger prot  26.0      49  0.0011   29.9   2.1   27   34-60      9-35  (201)
 82 cd02343 ZZ_EF Zinc finger, ZZ   26.0      33  0.0007   24.2   0.8   14    5-19      1-14  (48)
 83 smart00132 LIM Zinc-binding do  25.9      27 0.00059   21.3   0.4   12    6-17      1-12  (39)
 84 KOG3497 DNA-directed RNA polym  25.6      31 0.00067   25.8   0.7   13    3-15      3-15  (69)
 85 PF00645 zf-PARP:  Poly(ADP-rib  25.4      33 0.00072   25.5   0.8   13    6-18      9-21  (82)
 86 PF11793 FANCL_C:  FANCL C-term  25.3      42 0.00092   24.8   1.4   16   39-54     55-70  (70)
 87 PRK00423 tfb transcription ini  25.3      35 0.00077   32.0   1.2   26   40-66     12-37  (310)
 88 PF03604 DNA_RNApol_7kD:  DNA d  24.9      32 0.00069   22.2   0.6   13   40-52     18-30  (32)
 89 PF14353 CpXC:  CpXC protein     24.6      42  0.0009   27.1   1.3   45    5-51      2-50  (128)
 90 PRK03954 ribonuclease P protei  24.0      87  0.0019   26.1   3.1   44    5-54     65-108 (121)
 91 COG5188 PRP9 Splicing factor 3  23.5      24 0.00052   34.8  -0.3   14    6-19    376-389 (470)
 92 PRK11639 zinc uptake transcrip  23.4      61  0.0013   27.7   2.2   46    3-48     99-149 (169)
 93 TIGR02652 conserved hypothetic  23.1      34 0.00073   29.6   0.5   35   34-68      4-53  (163)
 94 KOG1296 Uncharacterized conser  23.1      27 0.00058   30.4  -0.1   47    3-52     29-77  (161)
 95 PF13790 DUF4182:  Domain of un  22.9   1E+02  0.0023   20.8   2.7   30    4-46      3-32  (38)
 96 KOG4582 Uncharacterized conser  22.6      51  0.0011   30.8   1.7   16    5-20    153-168 (278)
 97 PF04810 zf-Sec23_Sec24:  Sec23  22.5      39 0.00084   22.4   0.6   35    5-52      3-37  (40)
 98 PRK00807 50S ribosomal protein  22.2      27  0.0006   24.7  -0.1   43    6-58      3-47  (52)
 99 PRK04023 DNA polymerase II lar  21.9      43 0.00094   37.0   1.2    8    6-13    628-635 (1121)
100 PF14447 Prok-RING_4:  Prokaryo  21.8      49  0.0011   24.1   1.1   10   42-51     42-51  (55)
101 COG2023 RPR2 RNase P subunit R  21.4 1.3E+02  0.0027   24.7   3.5   38    5-51     57-94  (105)
102 PF10263 SprT-like:  SprT-like   21.3      98  0.0021   25.3   3.0   27   36-62    120-146 (157)
103 PF01927 Mut7-C:  Mut7-C RNAse   21.3      77  0.0017   26.5   2.4   46    2-49     89-134 (147)
104 PF04828 GFA:  Glutathione-depe  21.0 1.1E+02  0.0023   22.3   2.8   40   26-67     35-75  (92)
105 COG1013 PorB Pyruvate:ferredox  20.5      36 0.00079   32.1   0.2   18    5-22     16-33  (294)
106 TIGR03830 CxxCG_CxxCG_HTH puta  20.5 1.5E+02  0.0033   23.2   3.8    8   41-48     33-40  (127)
107 PF07255 Benyvirus_14KDa:  Beny  20.5      39 0.00084   27.8   0.4   42   33-74     59-100 (123)
108 PRK00464 nrdR transcriptional   20.2      60  0.0013   28.0   1.5   24   40-63      1-26  (154)

No 1  
>KOG2990 consensus C2C2-type Zn-finger protein [Function unknown]
Probab=100.00  E-value=2.7e-71  Score=504.14  Aligned_cols=253  Identities=49%  Similarity=0.755  Sum_probs=210.9

Q ss_pred             CCcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcccCCCcCChhhhhc
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQRKTEEFDVEDAET   80 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~GarR~~e~~~~~~~e~   80 (259)
                      |||||||++|.+||||||||||+|++||+||+||||+|+||||+|.|+|+|+|||+||||||+|||+|+.++||++|+|+
T Consensus        49 MPynIWC~gC~nhIgmGvRyNAeKkkvGnYYtTpiw~FrmKchlC~n~i~iqTDP~NceYvI~SGaqRKeer~D~~d~Eq  128 (317)
T KOG2990|consen   49 MPYNIWCDGCKNHIGMGVRYNAEKKKVGNYYTTPIWSFRMKCHLCDNYIVIQTDPKNCEYVITSGAQRKEERYDAEDAEQ  128 (317)
T ss_pred             cccchhhccHHHhhhccceechhhhhccccccCcccchhhcccccCCceeeecCCCCceEEEeccccccccccCchhhhh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cccCchhhhcCCC-ChhHHhhhhHHHHHHHHHHhHHHHHHHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHHHH----HH
Q 025008           81 LELPADEERGKLS-DPFYRLEHQEADLQKKKEAEPRLVQIQRISDGRFSDDYALNKALRAKLRSQRKRVTEEEA----AS  155 (259)
Q Consensus        81 ~~~~~~ee~~~~~-dpm~~LE~~~~D~~~~~~~~~~LeeL~~~~~~~~~Ddy~~N~~LR~~fR~~kk~~~~~e~----~~  155 (259)
                      ++..+.++.+++. |||++|||+..|.++.+.+.+.|..|++.++++|.|||.+|+.||++||++||..+++++    ..
T Consensus       129 ~~~t~~e~k~KLa~DamyrLEHqe~D~~k~k~aep~l~~l~e~~~~rw~Ddf~~ns~LRaqfR~~kK~~~e~~~~D~~l~  208 (317)
T KOG2990|consen  129 MEPTAEEEKGKLASDAMYRLEHQEVDLKKKKAAEPVLVRLQEVNDARWADDFQANSRLRAQFREEKKLINEQEARDLDLF  208 (317)
T ss_pred             ccchhhhhcccccccHHHHHHhHHHhHhhhhccchHHHHHHHHHHHHhccchhhhHHHHHHHHHHHHHhhhhhhhhHHHH
Confidence            9888888888885 999999999999999999999999999999999999999999999999999999987644    34


Q ss_pred             HhhCCCCCCCCCChHHHHHhcccCcchhhhhh-hH-HHHHhhhhcCCCCCCCCCcchhHHHHHHhhhcchhhhhhhhcCC
Q 025008          156 RKLGLGLRLLPSTKEDACAAAHVKFSSKFEKN-RK-DKRALINAASIFSGSSISSSKQLELEAKRRKINAGAASNMLTGA  233 (259)
Q Consensus       156 ~k~gl~i~Ll~e~eeD~~~A~~v~f~~~~~~~-~~-~kr~~i~~~siF~~~~~s~k~~~~~~~~r~k~~~~~a~~~l~~~  233 (259)
                      .+.+|+|.|||++++|+..|.+++|.....+. +. ..|..|.++ ++...+.|.+ ...+.  |.++.+..+++.+-|.
T Consensus       209 ~r~sl~I~lLPeTe~Dr~~A~llk~~~~~~kedr~~~~r~~i~sr-p~~~~S~sts-~g~l~--r~~~a~~~~~~~~lg~  284 (317)
T KOG2990|consen  209 ARASLDILLLPETEEDRKIASLLKFNTKKRKEDRENNRRLEIKSR-PSRTGSTSTS-SGSLK--RDPFARKFLPSEDLGI  284 (317)
T ss_pred             HhhhcCcccCCCchhhHHHHHHHhhcccchhhhHHhhhhhhhccC-CCCCCCcccc-ccccc--cchhhhcccchhhhhh
Confidence            57788999999999999999999997543332 23 344445444 4444343322 22333  8888888888888888


Q ss_pred             CcCCcccCCCCCCccccCCccccc
Q 025008          234 FKPSSWSQSSVPSSRHKRSSVSAR  257 (259)
Q Consensus       234 ~k~~~~~~~~~~~~~~~~~~~~~~  257 (259)
                      .+..+.+............+|..|
T Consensus       285 ~~~k~~st~~a~~~~~~~~~v~~~  308 (317)
T KOG2990|consen  285 RRRKIESTSNAAGEKLPDSSVSDR  308 (317)
T ss_pred             hhhhccCCcccCCCcCccchhccc
Confidence            887764443333333445555444


No 2  
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=100.00  E-value=2.3e-57  Score=423.79  Aligned_cols=175  Identities=41%  Similarity=0.670  Sum_probs=152.3

Q ss_pred             CCcceecCCCCccccccccccceeeccCc--eeeeeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcccCCCcCChhhh
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQVGN--YYSTKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQRKTEEFDVEDA   78 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~vg~--Y~st~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~GarR~~e~~~~~~~   78 (259)
                      |||+|||++|++|||+||||||+|++||+  |||||||+||||||.|+++|+|+|||+|+||||++||+|+++.|...+ 
T Consensus        37 ~Pf~i~C~~C~~~I~kG~rFNA~Ke~v~~E~Yls~~I~rF~~kC~~C~~~i~~kTDPkn~dY~~~~Ga~R~~~~~~~~~-  115 (324)
T PF04502_consen   37 MPFNIWCNTCGEYIYKGVRFNARKEKVGNEKYLSTPIYRFYIKCPRCSNEIEFKTDPKNTDYVVESGARRNFEPDKEEE-  115 (324)
T ss_pred             CCccCcCCCCccccccceeeeeeeEecCCCccccceEEEEEEEcCCCCCEEeeecCCCCCCeeeecCeeecCCcchhhh-
Confidence            89999999999999999999999999998  999999999999999999999999999999999999999777665443 


Q ss_pred             hccccCch-hhhcCCCChhHHhhhhHHHHHHHHHHhHHHHHHHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHHHh
Q 025008           79 ETLELPAD-EERGKLSDPFYRLEHQEADLQKKKEAEPRLVQIQRISDGRFSDDYALNKALRAKLRSQRKRVTEEEAASRK  157 (259)
Q Consensus        79 e~~~~~~~-ee~~~~~dpm~~LE~~~~D~~~~~~~~~~LeeL~~~~~~~~~Ddy~~N~~LR~~fR~~kk~~~~~e~~~~k  157 (259)
                      +++...+. ++.+...|||++||+++.|+++++++.++|++|++++.+  .|||+.|++||+.||.++++++.+++....
T Consensus       116 ~~~~~~~~~~~~~~~~d~m~~LE~~~~d~~~~~~~~~~LeeL~~~~~r--~d~~~~n~~Lr~~~r~~~k~~~~~~~~d~~  193 (324)
T PF04502_consen  116 EQEEREDKEEEEEEEEDPMKALEKRTEDSKREMEALERLEELQELNAR--KDDYDANQMLRKRFREEKKERERQEEEDEA  193 (324)
T ss_pred             hhhhhhhHHHhhhccCCchHHHHHHHHHHHHHHHHHHHHHHHHHHHhc--cCchhhHHHHHHHHHHHHHHHHHhHHHHHH
Confidence            33333333 333456899999999999999999999999999999987  899999999999999999998876665555


Q ss_pred             hCCCCCCCCCChHHHHHhccc
Q 025008          158 LGLGLRLLPSTKEDACAAAHV  178 (259)
Q Consensus       158 ~gl~i~Ll~e~eeD~~~A~~v  178 (259)
                      +...+.|.|++++|...+...
T Consensus       194 ~~~~~~~~~~~~~~~r~~~~~  214 (324)
T PF04502_consen  194 LKKKISLGPESEEDKRLAADE  214 (324)
T ss_pred             HHHhhccCcchhhhhhhhcch
Confidence            555555668899998887763


No 3  
>KOG2989 consensus Uncharacterized conserved protein [Function unknown]
Probab=100.00  E-value=9.4e-35  Score=260.33  Aligned_cols=128  Identities=31%  Similarity=0.562  Sum_probs=115.2

Q ss_pred             CCcceecCCCCccccccccccceeecc-C-ceeeeeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcccCCCcCChhhh
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQV-G-NYYSTKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQRKTEEFDVEDA   78 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~v-g-~Y~st~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~GarR~~e~~~~~~~   78 (259)
                      .||+|+|++||+|||+|++||+.++.| | .||||+||+|||+|+.|+++|+|+|||+|+|||+++||.|++++|...+.
T Consensus        37 ~Pf~~rC~tCgeyi~kg~kfN~r~E~~~~e~yLgiki~Rf~i~Ct~cl~el~~rTDp~N~dY~~E~Ga~r~y~~~~~~ee  116 (253)
T KOG2989|consen   37 TPFRLRCNTCGEYIYKGKKFNAREEDVIEETYLGIKIFRFYIKCTRCLRELSFRTDPKNSDYVIESGATRNYEPIEEEEE  116 (253)
T ss_pred             ccceeecccccchhhcCCCcchhHHhhhccccccceeeeeeeeccchHhhhhhhcCCcchHHHHHhcchhcccccchhHH
Confidence            599999999999999999999999998 3 89999999999999999999999999999999999999999999987665


Q ss_pred             hccccCchhhhcCCCChhHHhhhhHHHHHHHHHHhHHHHHHHHHHhcccCCHH
Q 025008           79 ETLELPADEERGKLSDPFYRLEHQEADLQKKKEAEPRLVQIQRISDGRFSDDY  131 (259)
Q Consensus        79 e~~~~~~~ee~~~~~dpm~~LE~~~~D~~~~~~~~~~LeeL~~~~~~~~~Ddy  131 (259)
                      +.-..  .++ +...|||..||+++.+++.++.....|++|..++.++...|+
T Consensus       117 ek~k~--~~~-~d~~d~m~~lekrt~~S~~e~~~~~~ldel~~~k~r~~~id~  166 (253)
T KOG2989|consen  117 EKRKF--EEE-EDMKDEIKRLEKRTFQSKDEEIIRRALDELKVLKERPAPIDL  166 (253)
T ss_pred             HHHHH--Hhh-hhhhhHHHHHHHHhhhhhhHHHHHHHHHHHHHHhcccCcccH
Confidence            43211  122 456799999999999999999999999999999999877777


No 4  
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=100.00  E-value=3.2e-34  Score=253.90  Aligned_cols=168  Identities=33%  Similarity=0.596  Sum_probs=130.6

Q ss_pred             CCcceecCCCCccccccccccceeeccC--ceeeeeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcccCCCcCChhhh
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQVG--NYYSTKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQRKTEEFDVEDA   78 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~vg--~Y~st~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~GarR~~e~~~~~~~   78 (259)
                      .||+|+|+.|++||++|+||||.|+-++  .||||+||||.|+||.|++.|-|+|||+|++||+++|++|++++-++.+.
T Consensus        39 TPF~~RCL~C~~YI~K~~rfNavkE~~~dK~y~~~kiYRf~I~C~~C~n~i~~RTDPkN~~YV~EsGg~R~i~pq~~n~D  118 (272)
T COG5134          39 TPFPVRCLNCENYIQKGTRFNAVKEEIGDKSYYTTKIYRFSIKCHLCSNPIDVRTDPKNTEYVVESGGRRKIEPQDINED  118 (272)
T ss_pred             cCcceeecchhhhhhcccchhHHHHHhcccccceeEEEEEEEEccCCCCceeeecCCCCceEEEecCceeecCccccccC
Confidence            4999999999999999999999999997  68999999999999999999999999999999999999999887665443


Q ss_pred             hccccCchhhhcCCCChhHHhhhhHHHHHHHHHHhHHHHHHHHHHhcccCCHHHHHHHHHHHHHHHHHHHHHHHHHH---
Q 025008           79 ETLELPADEERGKLSDPFYRLEHQEADLQKKKEAEPRLVQIQRISDGRFSDDYALNKALRAKLRSQRKRVTEEEAAS---  155 (259)
Q Consensus        79 e~~~~~~~ee~~~~~dpm~~LE~~~~D~~~~~~~~~~LeeL~~~~~~~~~Ddy~~N~~LR~~fR~~kk~~~~~e~~~---  155 (259)
                      +....  .-+.-...|....+|+..++..........+..+-.+..+-|+|+|...+.+|.+|+..|+.+..+++..   
T Consensus       119 ~~k~~--~Ve~~~Esd~~~~~eK~~~Q~~~~~~~ssA~n~~D~L~Krl~~~~~~~~~~~~~~~~~~k~~e~~q~a~~~~~  196 (272)
T COG5134         119 PAKAE--NVEKVPESDAIEALEKQLTQQKSEKHNSSAINFIDELNKRLWSDPFVSSQRLRKQFRERKKIEKKQEAKDLSL  196 (272)
T ss_pred             hhhhh--hhhcCchhHHHHHHHHHHHHhhcccchhhhhhHHHHHHHHhhcCchhhhHHHHHHHHHHhhhHHHHHHHHhhh
Confidence            21100  0011122466677777776666554444455566666778899999999999999999998886555432   


Q ss_pred             -HhhCCCCCCCCCChH
Q 025008          156 -RKLGLGLRLLPSTKE  170 (259)
Q Consensus       156 -~k~gl~i~Ll~e~ee  170 (259)
                       ....+.+.++|.+.+
T Consensus       197 ~~~a~~~~~i~~~~~d  212 (272)
T COG5134         197 KNRAALDIDILPSSSD  212 (272)
T ss_pred             hhhhhhhhccCCccch
Confidence             234568888887543


No 5  
>PF05907 DUF866:  Eukaryotic protein of unknown function (DUF866);  InterPro: IPR008584 This family consists of a number of hypothetical eukaryotic proteins of unknown function with an average length of around 165 residues.; PDB: 1ZSO_B.
Probab=90.36  E-value=0.26  Score=42.53  Aligned_cols=62  Identities=27%  Similarity=0.412  Sum_probs=35.0

Q ss_pred             CcceecCCCCccccccccccc-eeeccCceeeeeeEEEEEEcCCCCceeEEecCCC-CCCeeeecC
Q 025008            2 PFNIWCGGCNSMIAKGVRFNA-EKKQVGNYYSTKIWSFTMKSPCCKHQIVIQTDPK-NCEYVIISG   65 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNA-eKk~vg~Y~st~I~~F~mkC~~C~~~i~ikTDPk-n~dYvv~~G   65 (259)
                      .|.|.|+.|++--.+.|-+|. ++..+..  |---=.|.|||..|..+..|.--|. ...|.++..
T Consensus        28 ~fkvkCt~CgE~~~k~V~i~~~e~~e~~g--srG~aNfv~KCk~C~re~si~i~~~~~~~~~~e~~   91 (161)
T PF05907_consen   28 FFKVKCTSCGEVHPKWVYINRFEKHEIPG--SRGTANFVMKCKFCKRESSIDIIPGKGKPYTAEDS   91 (161)
T ss_dssp             EEEEEETTSS--EEEEEEE-TT-BEE-TT--SS-EESEEE--SSSS--EEEEEE--TTTEEEGGGT
T ss_pred             EEEEEECCCCCccCcceEeecceEEecCC--CccceEeEecCcCcCCccEEEEEecCccccccccc
Confidence            488999999998888888885 4444422  2222389999999999988854443 345665433


No 6  
>PF10122 Mu-like_Com:  Mu-like prophage protein Com;  InterPro: IPR019294  Members of this entry belong to the Com family of proteins that act as translational regulators of mom [, ]. 
Probab=88.80  E-value=0.43  Score=34.13  Aligned_cols=37  Identities=32%  Similarity=0.606  Sum_probs=28.0

Q ss_pred             CCcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEe
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQ   52 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ik   52 (259)
                      |.=.|+|.+|+...+++.          .|-     ...||||.|..--.|+
T Consensus         1 m~~eiRC~~CnklLa~~g----------~~~-----~leIKCpRC~tiN~~~   37 (51)
T PF10122_consen    1 MLKEIRCGHCNKLLAKAG----------EVI-----ELEIKCPRCKTINHVR   37 (51)
T ss_pred             CCcceeccchhHHHhhhc----------Ccc-----EEEEECCCCCccceEe
Confidence            445799999999998852          221     5789999999877764


No 7  
>PF08271 TF_Zn_Ribbon:  TFIIB zinc-binding;  InterPro: IPR013137 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a zinc finger motif found in transcription factor IIB (TFIIB). In eukaryotes the initiation of transcription of protein encoding genes by the polymerase II complexe (Pol II) is modulated by general and specific transcription factors. The general transcription factors operate through common promoters elements (such as the TATA box). At least seven different proteins associate to form the general transcription factors: TFIIA, -IIB, -IID, -IIE, -IIF, -IIG, and -IIH [].  TFIIB and TFIID are responsible for promoter recognition and interaction with pol II; together with Pol II, they form a minimal initiation complex capable of transcription under certain conditions. The TATA box of a Pol II promoter is bound in the initiation complex by the TBP subunit of TFIID, which bends the DNA around the C-terminal domain of TFIIB whereas the N-terminal zinc finger of TFIIB interacts with Pol II [, ]. The TFIIB zinc finger adopts a zinc ribbon fold characterised by two beta-hairpins forming two structurally similar zinc-binding sub-sites []. The zinc finger contacts the rbp1 subunit of Pol II through its dock domain, a conserved region of about 70 amino acids located close to the polymerase active site []. In the Pol II complex this surface is located near the RNA exit groove. Interestingly this sequence is best conserved in the three polymerases that utilise a TFIIB-like general transcription factor (Pol II, Pol III, and archaeal RNA polymerase) but not in Pol I [].  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1VD4_A 1PFT_A 3K1F_M 3K7A_M 1RO4_A 1RLY_A 1DL6_A.
Probab=88.32  E-value=0.3  Score=32.90  Aligned_cols=24  Identities=38%  Similarity=0.538  Sum_probs=21.6

Q ss_pred             EEcCCCCceeEEecCCCCCCeeeec
Q 025008           40 MKSPCCKHQIVIQTDPKNCEYVIIS   64 (259)
Q Consensus        40 mkC~~C~~~i~ikTDPkn~dYvv~~   64 (259)
                      |+||.|++.- |-+|+.+.+||+..
T Consensus         1 m~Cp~Cg~~~-~~~D~~~g~~vC~~   24 (43)
T PF08271_consen    1 MKCPNCGSKE-IVFDPERGELVCPN   24 (43)
T ss_dssp             ESBTTTSSSE-EEEETTTTEEEETT
T ss_pred             CCCcCCcCCc-eEEcCCCCeEECCC
Confidence            7899999988 89999999998865


No 8  
>smart00834 CxxC_CXXC_SSSS Putative regulatory protein. CxxC_CXXC_SSSS represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=82.19  E-value=1.1  Score=29.00  Aligned_cols=21  Identities=14%  Similarity=0.417  Sum_probs=16.4

Q ss_pred             eeeEEEEEEcCCCCceeEEecCC
Q 025008           33 TKIWSFTMKSPCCKHQIVIQTDP   55 (259)
Q Consensus        33 t~I~~F~mkC~~C~~~i~ikTDP   55 (259)
                      .|||.|  +|+.|+..|++-..-
T Consensus         1 Mp~Y~y--~C~~Cg~~fe~~~~~   21 (41)
T smart00834        1 MPIYEY--RCEDCGHTFEVLQKI   21 (41)
T ss_pred             CCCEEE--EcCCCCCEEEEEEec
Confidence            377877  899999999876643


No 9  
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=82.06  E-value=0.69  Score=37.62  Aligned_cols=30  Identities=20%  Similarity=0.538  Sum_probs=19.8

Q ss_pred             CCcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCce
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQ   48 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~   48 (259)
                      .|-..||..|+.                 ++..+-+ |++.||.|++.
T Consensus        67 ~p~~~~C~~Cg~-----------------~~~~~~~-~~~~CP~Cgs~   96 (114)
T PRK03681         67 QEAECWCETCQQ-----------------YVTLLTQ-RVRRCPQCHGD   96 (114)
T ss_pred             eCcEEEcccCCC-----------------eeecCCc-cCCcCcCcCCC
Confidence            377889999985                 3332222 33679999965


No 10 
>COG0375 HybF Zn finger protein HypA/HybF (possibly regulating hydrogenase expression) [General function prediction only]
Probab=79.67  E-value=1.6  Score=36.06  Aligned_cols=27  Identities=26%  Similarity=0.725  Sum_probs=21.7

Q ss_pred             CcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCc
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKH   47 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~   47 (259)
                      |--+||..|                 +.++..-.|.|+  ||.|++
T Consensus        68 p~~~~C~~C-----------------~~~~~~e~~~~~--CP~C~s   94 (115)
T COG0375          68 PAECWCLDC-----------------GQEVELEELDYR--CPKCGS   94 (115)
T ss_pred             ccEEEeccC-----------------CCeecchhheeE--CCCCCC
Confidence            556788888                 677888888888  999984


No 11 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=78.19  E-value=1  Score=26.91  Aligned_cols=15  Identities=27%  Similarity=0.884  Sum_probs=12.3

Q ss_pred             ecCCCCccccccccc
Q 025008            6 WCGGCNSMIAKGVRF   20 (259)
Q Consensus         6 wC~~C~~~I~kGvRF   20 (259)
                      .|..||+.|-.+.+|
T Consensus         1 ~Cp~CG~~~~~~~~f   15 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKF   15 (23)
T ss_pred             CCcccCCCCCCcCcc
Confidence            388888888888887


No 12 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=77.19  E-value=1.2  Score=36.15  Aligned_cols=12  Identities=33%  Similarity=1.060  Sum_probs=9.3

Q ss_pred             CCcceecCCCCc
Q 025008            1 MPFNIWCGGCNS   12 (259)
Q Consensus         1 mPF~iwC~~C~~   12 (259)
                      .|-.+||..|+.
T Consensus        67 vp~~~~C~~Cg~   78 (113)
T PRK12380         67 KPAQAWCWDCSQ   78 (113)
T ss_pred             eCcEEEcccCCC
Confidence            377789999984


No 13 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=76.18  E-value=1.3  Score=36.13  Aligned_cols=29  Identities=10%  Similarity=0.240  Sum_probs=18.7

Q ss_pred             CcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCce
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQ   48 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~   48 (259)
                      |.-+||..|+....-.                 =| ++++||.|++.
T Consensus        69 p~~~~C~~Cg~~~~~~-----------------~~-~~~~CP~Cgs~   97 (117)
T PRK00564         69 KVELECKDCSHVFKPN-----------------AL-DYGVCEKCHSK   97 (117)
T ss_pred             CCEEEhhhCCCccccC-----------------Cc-cCCcCcCCCCC
Confidence            7778999998443221                 11 33579999975


No 14 
>TIGR02605 CxxC_CxxC_SSSS putative regulatory protein, FmdB family. This model represents a region of about 50 amino acids found in a number of small proteins in a wide range of bacteria. The region begins usually with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One member of this family is has been noted as a putative regulatory protein, designated FmdB (PubMed:8841393). Most members of this family have a C-terminal region containing highly degenerate sequence, such as SSTSESTKSSGSSGSSGSSESKASGSTEKSTSSTTAAAAV in Mycobacterium tuberculosis and VAVGGSAPAPSPAPRAGGGGGGCCGGGCCG in Streptomyces avermitilis. These low complexity regions, which are not included in the model, resemble low-complexity C-terminal regions of some heterocycle-containing bacteriocin precursors.
Probab=74.82  E-value=2.3  Score=29.25  Aligned_cols=18  Identities=17%  Similarity=0.632  Sum_probs=14.1

Q ss_pred             eeeEEEEEEcCCCCceeEEe
Q 025008           33 TKIWSFTMKSPCCKHQIVIQ   52 (259)
Q Consensus        33 t~I~~F~mkC~~C~~~i~ik   52 (259)
                      .|||.|  +|..|+..|++-
T Consensus         1 MP~Yey--~C~~Cg~~fe~~   18 (52)
T TIGR02605         1 MPIYEY--RCTACGHRFEVL   18 (52)
T ss_pred             CCCEEE--EeCCCCCEeEEE
Confidence            377777  689999988875


No 15 
>PF09855 DUF2082:  Nucleic-acid-binding protein containing Zn-ribbon domain (DUF2082);  InterPro: IPR018652  This family of proteins contains various hypothetical prokaryotic proteins as well as some Zn-ribbon nucleic-acid-binding proteins.
Probab=69.88  E-value=4.5  Score=30.08  Aligned_cols=47  Identities=13%  Similarity=0.176  Sum_probs=35.2

Q ss_pred             ecCCCCccccccccccceeeccCceeeeeeEEEEEE-cCCCCceeEEe
Q 025008            6 WCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMK-SPCCKHQIVIQ   52 (259)
Q Consensus         6 wC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mk-C~~C~~~i~ik   52 (259)
                      .|.+|++..+.=..+.+.-..+++.+.+..-+|+.. |+.|+-.=-.+
T Consensus         2 ~C~KCg~~~~e~~~v~~tgg~~skiFdvq~~~f~~v~C~~CGYTE~Y~   49 (64)
T PF09855_consen    2 KCPKCGNEEYESGEVRATGGGLSKIFDVQNKKFTTVSCTNCGYTEFYK   49 (64)
T ss_pred             CCCCCCCcceecceEEccCCeeEEEEEecCcEEEEEECCCCCCEEEEe
Confidence            499999987777777776666667788877788765 99998763334


No 16 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=66.79  E-value=3.2  Score=33.75  Aligned_cols=28  Identities=18%  Similarity=0.430  Sum_probs=17.9

Q ss_pred             CcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCce
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQ   48 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~   48 (259)
                      |-.+||..|+....-.                   .+.+.||.|++.
T Consensus        68 p~~~~C~~Cg~~~~~~-------------------~~~~~CP~Cgs~   95 (115)
T TIGR00100        68 PVECECEDCSEEVSPE-------------------IDLYRCPKCHGI   95 (115)
T ss_pred             CcEEEcccCCCEEecC-------------------CcCccCcCCcCC
Confidence            6678888888432221                   114679999874


No 17 
>COG4332 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=64.70  E-value=3.3  Score=37.00  Aligned_cols=39  Identities=26%  Similarity=0.540  Sum_probs=28.1

Q ss_pred             ceecCCCC---ccccccc-cccceeeccCceeeeeeEEEEEEcCCCCcee
Q 025008            4 NIWCGGCN---SMIAKGV-RFNAEKKQVGNYYSTKIWSFTMKSPCCKHQI   49 (259)
Q Consensus         4 ~iwC~~C~---~~I~kGv-RFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i   49 (259)
                      -..|++||   +|+.-|. |-||.++.++.++   ||    ||..|++..
T Consensus        17 ~k~C~~Cg~kr~f~cSg~fRvNAq~K~LDvWl---IY----kC~~Cd~tW   59 (203)
T COG4332          17 AKRCNSCGVKRAFTCSGKFRVNAQGKVLDVWL---IY----KCTHCDYTW   59 (203)
T ss_pred             hhhCcccCCcceeeecCcEEEcCCCcEEEEEE---EE----EeeccCCcc
Confidence            35799998   5788885 8899888776433   33    799887653


No 18 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=62.59  E-value=6.2  Score=24.08  Aligned_cols=11  Identities=36%  Similarity=0.754  Sum_probs=7.1

Q ss_pred             cCCCCcccccc
Q 025008            7 CGGCNSMIAKG   17 (259)
Q Consensus         7 C~~C~~~I~kG   17 (259)
                      |..||..|.-.
T Consensus         1 C~sC~~~i~~r   11 (24)
T PF07754_consen    1 CTSCGRPIAPR   11 (24)
T ss_pred             CccCCCcccCc
Confidence            77787666533


No 19 
>PRK03824 hypA hydrogenase nickel incorporation protein; Provisional
Probab=62.23  E-value=4.4  Score=33.87  Aligned_cols=43  Identities=14%  Similarity=0.299  Sum_probs=22.4

Q ss_pred             CcceecCCCCccccccccccceeeccCc------eeeeeeEEEEEEcCCCCce
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGN------YYSTKIWSFTMKSPCCKHQ   48 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~------Y~st~I~~F~mkC~~C~~~   48 (259)
                      |--.||..||....-.    ..+.+++-      -|.--...+.++||.|++.
T Consensus        68 p~~~~C~~CG~~~~~~----~~~~~~~~~~~~~~~~~~~~~~~~~~CP~Cgs~  116 (135)
T PRK03824         68 EAVLKCRNCGNEWSLK----EVKESLDEEIREAIHFIPEVVHAFLKCPKCGSR  116 (135)
T ss_pred             ceEEECCCCCCEEecc----cccccccccccccccccccccccCcCCcCCCCC
Confidence            6678999998321110    01222221      1222233566889999864


No 20 
>COG2888 Predicted Zn-ribbon RNA-binding protein with a function in translation [Translation, ribosomal structure and biogenesis]
Probab=61.15  E-value=7.1  Score=28.93  Aligned_cols=32  Identities=22%  Similarity=0.394  Sum_probs=24.0

Q ss_pred             ceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEe
Q 025008            4 NIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQ   52 (259)
Q Consensus         4 ~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ik   52 (259)
                      ...|+.||.-|.-|.++=                 .|.||.|++.+.+|
T Consensus         9 ~~~CtSCg~~i~p~e~~v-----------------~F~CPnCGe~~I~R   40 (61)
T COG2888           9 PPVCTSCGREIAPGETAV-----------------KFPCPNCGEVEIYR   40 (61)
T ss_pred             CceeccCCCEeccCCcee-----------------EeeCCCCCceeeeh
Confidence            457999999887766553                 36899999777665


No 21 
>PRK04016 DNA-directed RNA polymerase subunit N; Provisional
Probab=57.72  E-value=5.4  Score=29.64  Aligned_cols=16  Identities=31%  Similarity=0.623  Sum_probs=13.0

Q ss_pred             CCcceecCCCCccccc
Q 025008            1 MPFNIWCGGCNSMIAK   16 (259)
Q Consensus         1 mPF~iwC~~C~~~I~k   16 (259)
                      |=|+|+|-+||.-|+-
T Consensus         1 MiiPvRCFTCGkvi~~   16 (62)
T PRK04016          1 MMIPVRCFTCGKVIAE   16 (62)
T ss_pred             CCCCeEecCCCCChHH
Confidence            6688999999988753


No 22 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=57.21  E-value=6.2  Score=40.16  Aligned_cols=36  Identities=19%  Similarity=0.434  Sum_probs=26.3

Q ss_pred             ceeeeeeEEEEEEcCCCCceeEEe---------cCCCCCCeeeec
Q 025008           29 NYYSTKIWSFTMKSPCCKHQIVIQ---------TDPKNCEYVIIS   64 (259)
Q Consensus        29 ~Y~st~I~~F~mkC~~C~~~i~ik---------TDPkn~dYvv~~   64 (259)
                      .|......+|+..||.|+.+.+++         .+|+.+-|+|.+
T Consensus       190 ~~~~sdqr~~~vpCPhCg~~~~l~~~~l~w~~~~~~~~a~y~C~~  234 (557)
T PF05876_consen  190 LYEESDQRRYYVPCPHCGEEQVLEWENLKWDKGEAPETARYVCPH  234 (557)
T ss_pred             HHHhCCceEEEccCCCCCCCccccccceeecCCCCccceEEECCC
Confidence            455555668889999998887764         257888888854


No 23 
>PRK00762 hypA hydrogenase nickel incorporation protein; Provisional
Probab=56.63  E-value=5  Score=33.04  Aligned_cols=12  Identities=33%  Similarity=0.819  Sum_probs=9.1

Q ss_pred             CCcceecCCCCcc
Q 025008            1 MPFNIWCGGCNSM   13 (259)
Q Consensus         1 mPF~iwC~~C~~~   13 (259)
                      .|-..|| .|+.+
T Consensus        67 vp~~~~C-~Cg~~   78 (124)
T PRK00762         67 IPVEIEC-ECGYE   78 (124)
T ss_pred             cCeeEEe-eCcCc
Confidence            3778899 99843


No 24 
>PF01921 tRNA-synt_1f:  tRNA synthetases class I (K);  InterPro: IPR002904 The aminoacyl-tRNA synthetases (6.1.1. from EC) catalyse the attachment of an amino acid to its cognate transfer RNA molecule in a highly specific two-step reaction. These proteins differ widely in size and oligomeric state, and have limited sequence homology []. The 20 aminoacyl-tRNA synthetases are divided into two classes, I and II. Class I aminoacyl-tRNA synthetases contain a characteristic Rossman fold catalytic domain and are mostly monomeric []. Class II aminoacyl-tRNA synthetases share an anti-parallel beta-sheet fold flanked by alpha-helices [], and are mostly dimeric or multimeric, containing at least three conserved regions [, , ]. However, tRNA binding involves an alpha-helical structure that is conserved between class I and class II synthetases. In reactions catalysed by the class I aminoacyl-tRNA synthetases, the aminoacyl group is coupled to the 2'-hydroxyl of the tRNA, while, in class II reactions, the 3'-hydroxyl site is preferred. The synthetases specific for arginine, cysteine, glutamic acid, glutamine, isoleucine, leucine, methionine, tyrosine, tryptophan and valine belong to class I synthetases. The synthetases specific for alanine, asparagine, aspartic acid, glycine, histidine, lysine, phenylalanine, proline, serine, and threonine belong to class-II synthetases []. Based on their mode of binding to the tRNA acceptor stem, both classes of tRNA synthetases have been subdivided into three subclasses, designated 1a, 1b, 1c and 2a, 2b, 2c. Lysyl-tRNA synthetase (6.1.1.6 from EC) is an alpha 2 homodimer that belong to both class I and class II. In eubacteria and eukaryota lysyl-tRNA synthetases belong to class II in the same family as aspartyl tRNA synthetase. The class Ic lysyl-tRNA synthetase family is present in archaea and in a number of bacterial groups that include the alphaproteobacteria and spirochaetes[]. A refined crystal structures shows that the active site of LysU is shaped to position the substrates for the nucleophilic attack of the lysine carboxylate on the ATP alpha-phosphate. No residues are directly involved in catalysis, but a number of highly conserved amino acids and three metal ions coordinate the substrates and stabilise the pentavalent transition state. A loop close to the catalytic pocket, disordered in the lysine-bound structure, becomes ordered upon adenine binding [].; GO: 0000166 nucleotide binding, 0004824 lysine-tRNA ligase activity, 0005524 ATP binding, 0006430 lysyl-tRNA aminoacylation, 0005737 cytoplasm; PDB: 1IRX_A.
Probab=56.34  E-value=6.7  Score=38.22  Aligned_cols=41  Identities=22%  Similarity=0.425  Sum_probs=22.2

Q ss_pred             CCcceecCCCCc-cccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEe
Q 025008            1 MPFNIWCGGCNS-MIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQ   52 (259)
Q Consensus         1 mPF~iwC~~C~~-~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ik   52 (259)
                      .||+..|..||. .--.=+.||++..+|           +..|+.|+++.++.
T Consensus       171 ~Pf~piC~~cGri~tt~v~~~d~~~~~v-----------~Y~c~~cG~~g~~~  212 (360)
T PF01921_consen  171 SPFLPICEKCGRIDTTEVTEYDPEGGTV-----------TYRCEECGHEGEVD  212 (360)
T ss_dssp             -SEEEEETTTEE--EEEEEEE--SSSEE-----------EEE--TTS---EEE
T ss_pred             eeeeeeccccCCcccceeeEeecCCCEE-----------EEEecCCCCEEEEe
Confidence            399999999997 333334555544444           46789999887753


No 25 
>COG1644 RPB10 DNA-directed RNA polymerase, subunit N (RpoN/RPB10) [Transcription]
Probab=54.91  E-value=5.7  Score=29.59  Aligned_cols=24  Identities=21%  Similarity=0.529  Sum_probs=16.2

Q ss_pred             CCcceecCCCCccccccccccceeec
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQ   26 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~   26 (259)
                      |=++|+|-+||.-||  -.|+.=|+.
T Consensus         1 MiiPiRCFsCGkvi~--~~w~~y~~r   24 (63)
T COG1644           1 MIIPVRCFSCGKVIG--HKWEEYKRR   24 (63)
T ss_pred             CCCceEeecCCCCHH--HHHHHHHHH
Confidence            568899999998874  344443333


No 26 
>PF04502 DUF572:  Family of unknown function (DUF572) ;  InterPro: IPR007590 This entry represents eukaryotic proteins with undetermined function belonging to the CWC16 family.
Probab=53.18  E-value=7.1  Score=37.09  Aligned_cols=20  Identities=15%  Similarity=0.159  Sum_probs=14.9

Q ss_pred             eeeeEE----EEEEcCCCCceeEE
Q 025008           32 STKIWS----FTMKSPCCKHQIVI   51 (259)
Q Consensus        32 st~I~~----F~mkC~~C~~~i~i   51 (259)
                      ++.+.|    |.|.|..|+++|-.
T Consensus        29 ~~~~VRf~~Pf~i~C~~C~~~I~k   52 (324)
T PF04502_consen   29 GILTVRFMMPFNIWCNTCGEYIYK   52 (324)
T ss_pred             cceEEEEcCCccCcCCCCcccccc
Confidence            455555    57899999999863


No 27 
>PRK14890 putative Zn-ribbon RNA-binding protein; Provisional
Probab=52.75  E-value=16  Score=26.92  Aligned_cols=18  Identities=39%  Similarity=0.578  Sum_probs=12.3

Q ss_pred             cceecCCCCcccc---ccccc
Q 025008            3 FNIWCGGCNSMIA---KGVRF   20 (259)
Q Consensus         3 F~iwC~~C~~~I~---kGvRF   20 (259)
                      ....|+.||..|.   +||+|
T Consensus         6 ~~~~CtSCg~~i~~~~~~~~F   26 (59)
T PRK14890          6 EPPKCTSCGIEIAPREKAVKF   26 (59)
T ss_pred             cCccccCCCCcccCCCccCEe
Confidence            3457999998775   35554


No 28 
>PF11931 DUF3449:  Domain of unknown function (DUF3449);  InterPro: IPR024598 This presumed domain is functionally uncharacterised. It has two conserved sequence motifs: PIP and CEICG and contains a zinc-finger of the C2H2-type.; PDB: 4DGW_A.
Probab=52.23  E-value=4.7  Score=36.17  Aligned_cols=32  Identities=13%  Similarity=0.268  Sum_probs=0.0

Q ss_pred             ecCCCCccccccccccceeeccCceeeeeeEEEEEEcC
Q 025008            6 WCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSP   43 (259)
Q Consensus         6 wC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~   43 (259)
                      -|.=||+++|+|.|      .-.+.|+-+-+.|-|+|=
T Consensus       103 ~CEICGN~~Y~Grk------aFekHF~E~rH~~GlrcL  134 (196)
T PF11931_consen  103 KCEICGNQSYKGRK------AFEKHFQEWRHAYGLRCL  134 (196)
T ss_dssp             --------------------------------------
T ss_pred             eeEeCCCcceecHH------HHHHhcChhHHHccChhc
Confidence            49999999999954      445667777777777774


No 29 
>cd02340 ZZ_NBR1_like Zinc finger, ZZ type. Zinc finger present in Drosophila ref(2)P, NBR1, Human sequestosome 1 and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Drosophila ref(2)P appears to control the multiplication of sigma rhabdovirus. NBR1 (Next to BRCA1 gene 1 protein) interacts with fasciculation and elongation protein zeta-1 (FEZ1) and calcium and integrin binding protein (CIB), and may function in cell signalling pathways. Sequestosome 1 is a phosphotyrosine independent ligand for the Lck SH2 domain and binds noncovalently to ubiquitin via its UBA domain.
Probab=52.07  E-value=6.9  Score=26.57  Aligned_cols=17  Identities=41%  Similarity=1.040  Sum_probs=11.5

Q ss_pred             eecCCCCccccccccccc
Q 025008            5 IWCGGCNSMIAKGVRFNA   22 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFNA   22 (259)
                      |.|.+|+..| .|.||--
T Consensus         1 v~Cd~C~~~i-~G~ry~C   17 (43)
T cd02340           1 VICDGCQGPI-VGVRYKC   17 (43)
T ss_pred             CCCCCCCCcC-cCCeEEC
Confidence            5688888744 7776643


No 30 
>PRK00398 rpoP DNA-directed RNA polymerase subunit P; Provisional
Probab=51.86  E-value=13  Score=25.16  Aligned_cols=18  Identities=22%  Similarity=0.648  Sum_probs=14.5

Q ss_pred             EEEcCCCCceeEEecCCC
Q 025008           39 TMKSPCCKHQIVIQTDPK   56 (259)
Q Consensus        39 ~mkC~~C~~~i~ikTDPk   56 (259)
                      .++||.|++.+.++-.|.
T Consensus        21 ~~~Cp~CG~~~~~~~~~~   38 (46)
T PRK00398         21 GVRCPYCGYRILFKERPP   38 (46)
T ss_pred             ceECCCCCCeEEEccCCC
Confidence            478999999999876553


No 31 
>PRK00750 lysK lysyl-tRNA synthetase; Reviewed
Probab=51.57  E-value=11  Score=38.14  Aligned_cols=39  Identities=28%  Similarity=0.600  Sum_probs=26.9

Q ss_pred             CCcceecCCCCccccccc-cccceeeccCceeeeeeEEEEEEcCCCCceeEE
Q 025008            1 MPFNIWCGGCNSMIAKGV-RFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVI   51 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGv-RFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~i   51 (259)
                      .||+..|..||..-.-.| -||++..+|. |          .|. |+++.+.
T Consensus       172 ~P~~pic~~cg~~~~~~~~~~d~~~~~v~-y----------~~~-cG~~~~~  211 (510)
T PRK00750        172 SPFLPICPKCGKVLTTPVISYDAEAGTVT-Y----------DCE-CGHEGEV  211 (510)
T ss_pred             eeeeeeCCCCCccceEEEEEEeCCCCEEE-E----------EcC-CCCEEEE
Confidence            399999999997765555 6777766552 2          454 7776654


No 32 
>PF13005 zf-IS66:  zinc-finger binding domain of transposase IS66 ;  InterPro: IPR024474 This entry represents a predicted helix-turn-helix domain from insertion element IS66 transposases [].
Probab=51.52  E-value=26  Score=23.37  Aligned_cols=41  Identities=17%  Similarity=0.344  Sum_probs=27.3

Q ss_pred             ecCCCCccccc-cccccceeecc--CceeeeeeEEEEEEcCCCC
Q 025008            6 WCGGCNSMIAK-GVRFNAEKKQV--GNYYSTKIWSFTMKSPCCK   46 (259)
Q Consensus         6 wC~~C~~~I~k-GvRFNAeKk~v--g~Y~st~I~~F~mkC~~C~   46 (259)
                      -|..||..+.. |..+=.+.-.+  ..++=+.++++...|+.|+
T Consensus         4 ~C~~Cg~~l~~ig~~~~~q~l~~~p~~~~V~e~~~~~y~C~~C~   47 (47)
T PF13005_consen    4 ACPDCGGELKEIGEEKVRQVLDLPPAKPEVTEHVRHKYACPCCG   47 (47)
T ss_pred             cCCCCCceeeECCceeeEEEEeecccceEEEEEEeceEECCCCC
Confidence            48889875542 44432222222  3677899999999999995


No 33 
>KOG2407 consensus GPI transamidase complex, GPI16/PIG-T component, involved in glycosylphosphatidylinositol anchor biosynthesis [Cell wall/membrane/envelope biogenesis; Posttranslational modification, protein turnover, chaperones]
Probab=50.44  E-value=6  Score=40.32  Aligned_cols=12  Identities=42%  Similarity=1.085  Sum_probs=10.9

Q ss_pred             CCcceecCCCCc
Q 025008            1 MPFNIWCGGCNS   12 (259)
Q Consensus         1 mPF~iwC~~C~~   12 (259)
                      |||||+|.+|--
T Consensus       495 MPYNVIcltcTv  506 (575)
T KOG2407|consen  495 MPYNVICLTCTV  506 (575)
T ss_pred             CceeEEeeehhh
Confidence            999999999964


No 34 
>KOG3368 consensus Transport protein particle (TRAPP) complex subunit [Intracellular trafficking, secretion, and vesicular transport]
Probab=49.13  E-value=23  Score=30.17  Aligned_cols=32  Identities=22%  Similarity=0.285  Sum_probs=30.3

Q ss_pred             ceeeeeeEEEEEEcCCCCceeEEecCCCCCCe
Q 025008           29 NYYSTKIWSFTMKSPCCKHQIVIQTDPKNCEY   60 (259)
Q Consensus        29 ~Y~st~I~~F~mkC~~C~~~i~ikTDPkn~dY   60 (259)
                      .||+|--|...+-|+.-+=+|++-|||+..+|
T Consensus        62 ~sy~Ts~YklhfyeTptglk~vl~Tdpk~~~i   93 (140)
T KOG3368|consen   62 LSYKTSKYKLHFYETPTGLKFVLNTDPKAGSI   93 (140)
T ss_pred             eEEeeceeEEEEEEcCCCcEEEEecCCCcccH
Confidence            79999999999999999999999999998775


No 35 
>PF01155 HypA:  Hydrogenase expression/synthesis hypA family;  InterPro: IPR000688 Bacterial membrane-bound nickel-dependent hydrogenases requires a number of accessory proteins which are involved in their maturation. The exact role of these proteins is not yet clear, but some seem to be required for the incorporation of the nickel ions []. One of these proteins is generally known as hypA. It is a protein of about 12 to 14 kDa that contains, in its C-terminal region, four conserved cysteines that form a zinc-finger like motif. Escherichia coli has two proteins that belong to this family, hypA and hybF. A homologue, MJ0214, has also been found in a number of archaeal species, including the genome of Methanocaldococcus jannaschii (Methanococcus jannaschii).; GO: 0016151 nickel ion binding, 0006464 protein modification process; PDB: 2KDX_A 3A44_D 3A43_B.
Probab=47.99  E-value=8.8  Score=30.99  Aligned_cols=11  Identities=27%  Similarity=0.773  Sum_probs=6.4

Q ss_pred             CcceecCCCCc
Q 025008            2 PFNIWCGGCNS   12 (259)
Q Consensus         2 PF~iwC~~C~~   12 (259)
                      |...||..|+.
T Consensus        68 p~~~~C~~Cg~   78 (113)
T PF01155_consen   68 PARARCRDCGH   78 (113)
T ss_dssp             --EEEETTTS-
T ss_pred             CCcEECCCCCC
Confidence            66778888874


No 36 
>PF05876 Terminase_GpA:  Phage terminase large subunit (GpA);  InterPro: IPR008866 This entry is represented by Bacteriophage lambda, GpA. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This entry consists of several phage terminase large subunit proteins as well as related sequences from several bacterial species. The DNA packaging enzyme of bacteriophage lambda, terminase, is a heteromultimer composed of a small subunit, gpNu1, and a large subunit, gpA, products of the Nu1 and A genes, respectively. Terminase is involved in the site-specific binding and cutting of the DNA in the initial stages of packaging. It is now known that gpA is actively involved in late stages of packaging, including DNA translocation, and that this enzyme contains separate functional domains for its early and late packaging activities [].
Probab=47.64  E-value=9.1  Score=38.98  Aligned_cols=39  Identities=13%  Similarity=0.308  Sum_probs=27.8

Q ss_pred             cceecCCCCccc---cccccccceeeccCceeeeeeEEEEEEcCCCCceeE
Q 025008            3 FNIWCGGCNSMI---AKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIV   50 (259)
Q Consensus         3 F~iwC~~C~~~I---~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~   50 (259)
                      |.+-|.+|+++.   ..+.+|+-.-         .--.-++.|+.|+..|+
T Consensus       199 ~~vpCPhCg~~~~l~~~~l~w~~~~---------~~~~a~y~C~~Cg~~i~  240 (557)
T PF05876_consen  199 YYVPCPHCGEEQVLEWENLKWDKGE---------APETARYVCPHCGCEIE  240 (557)
T ss_pred             EEccCCCCCCCccccccceeecCCC---------CccceEEECCCCcCCCC
Confidence            678899999763   3567774221         33456789999999986


No 37 
>PLN00032 DNA-directed RNA polymerase; Provisional
Probab=47.51  E-value=10  Score=28.99  Aligned_cols=15  Identities=27%  Similarity=0.592  Sum_probs=11.5

Q ss_pred             CCcceecCCCCcccc
Q 025008            1 MPFNIWCGGCNSMIA   15 (259)
Q Consensus         1 mPF~iwC~~C~~~I~   15 (259)
                      |=++|+|=+||..||
T Consensus         1 MiiPVRCFTCGkvig   15 (71)
T PLN00032          1 MIIPVRCFTCGKVIG   15 (71)
T ss_pred             CCCceeecCCCCCcH
Confidence            557888888888774


No 38 
>PF05973 Gp49:  Phage derived protein Gp49-like (DUF891);  InterPro: IPR009241 This entry consists of several hypothetical viral and bacterial proteins some are annotated as addiction module killer proteins.
Probab=47.50  E-value=35  Score=25.77  Aligned_cols=46  Identities=15%  Similarity=0.185  Sum_probs=37.9

Q ss_pred             ceee-eeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcccCCCcCCh
Q 025008           29 NYYS-TKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQRKTEEFDV   75 (259)
Q Consensus        29 ~Y~s-t~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~GarR~~e~~~~   75 (259)
                      .++. ..||.+++.+.....-+.+-.++.+ .+|+.+|..++.+....
T Consensus        34 k~l~~~~i~ElR~~~~~~~~Ri~y~~~~~~-~ivll~~f~Kkt~k~p~   80 (91)
T PF05973_consen   34 KHLKGDGIYELRVRGGSNIYRILYFFDGGD-IIVLLHGFIKKTQKTPK   80 (91)
T ss_pred             cccCcCCeEEEEEeecCCcceEEEEEcCcc-EEEEEEEEEeCCCCCCH
Confidence            4555 8999999999998888999998888 88999999888754433


No 39 
>COG1405 SUA7 Transcription initiation factor TFIIIB, Brf1 subunit/Transcription initiation factor TFIIB [Transcription]
Probab=45.85  E-value=11  Score=35.59  Aligned_cols=26  Identities=31%  Similarity=0.337  Sum_probs=22.9

Q ss_pred             EEcCCCCceeEEecCCCCCCeeeecCc
Q 025008           40 MKSPCCKHQIVIQTDPKNCEYVIISGA   66 (259)
Q Consensus        40 mkC~~C~~~i~ikTDPkn~dYvv~~Ga   66 (259)
                      |.||.|+.. .|-+|+++.+|||..=+
T Consensus         2 ~~CpeCg~~-~~~~d~~~ge~VC~~CG   27 (285)
T COG1405           2 MSCPECGST-NIITDYERGEIVCADCG   27 (285)
T ss_pred             CCCCCCCCc-cceeeccCCeEEeccCC
Confidence            679999999 99999999999997633


No 40 
>PF01194 RNA_pol_N:  RNA polymerases N / 8 kDa subunit;  InterPro: IPR000268 In eukaryotes, there are three different forms of DNA-dependent RNA polymerases (2.7.7.6 from EC) transcribing different sets of genes. Each class of RNA polymerase is an assemblage of ten to twelve different polypeptides. In archaebacteria, there is generally a single form of RNA polymerase which also consists of an oligomeric assemblage of 10 to 13 polypeptides. Archaebacterial subunit N (gene rpoN) [] is a small protein of about 8 kDa, it is evolutionary related [] to a 8.3 kDa component shared by all three forms of eukaryotic RNA polymerases (gene RPB10 in yeast and POLR2J in mammals) as well as to African swine fever virus (ASFV) protein CP80R []. There is a conserved region which is located at the N-terminal extremity of these polymerase subunits; this region contains two cysteines that binds a zinc ion [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_N 3HKZ_N 1EF4_A 3H0G_V 2Y0S_N 2R92_J 3M4O_J 3S2D_J 1R9S_J 1Y1W_J ....
Probab=43.24  E-value=10  Score=28.03  Aligned_cols=15  Identities=27%  Similarity=0.592  Sum_probs=9.5

Q ss_pred             CCcceecCCCCcccc
Q 025008            1 MPFNIWCGGCNSMIA   15 (259)
Q Consensus         1 mPF~iwC~~C~~~I~   15 (259)
                      |=+.|+|-+||..|+
T Consensus         1 MiiPVRCFTCGkvi~   15 (60)
T PF01194_consen    1 MIIPVRCFTCGKVIG   15 (60)
T ss_dssp             ---SSS-STTTSBTC
T ss_pred             CCCceecCCCCCChh
Confidence            457889999998875


No 41 
>TIGR02098 MJ0042_CXXC MJ0042 family finger-like domain. This domain contains a CXXCX(19)CXXC motif suggestive of both zinc fingers and thioredoxin, usually found at the N-terminus of prokaryotic proteins. One partially characterized gene, agmX, is among a large set in Myxococcus whose interruption affects adventurous gliding motility.
Probab=42.58  E-value=13  Score=23.86  Aligned_cols=18  Identities=17%  Similarity=0.429  Sum_probs=15.1

Q ss_pred             EEEcCCCCceeEEecCCC
Q 025008           39 TMKSPCCKHQIVIQTDPK   56 (259)
Q Consensus        39 ~mkC~~C~~~i~ikTDPk   56 (259)
                      .+.||.|+..+.|..|+-
T Consensus         2 ~~~CP~C~~~~~v~~~~~   19 (38)
T TIGR02098         2 RIQCPNCKTSFRVVDSQL   19 (38)
T ss_pred             EEECCCCCCEEEeCHHHc
Confidence            478999999999987754


No 42 
>TIGR01206 lysW lysine biosynthesis protein LysW. This very small, poorly characterized protein has been shown essential in Thermus thermophilus for an unusual pathway of Lys biosynthesis from aspartate by way of alpha-aminoadipate (AAA) rather than diaminopimelate. It is found also in Deinococcus radiodurans and Pyrococcus horikoshii, which appear to share the AAA pathway.
Probab=42.34  E-value=18  Score=26.00  Aligned_cols=12  Identities=25%  Similarity=0.656  Sum_probs=6.3

Q ss_pred             EcCCCCceeEEe
Q 025008           41 KSPCCKHQIVIQ   52 (259)
Q Consensus        41 kC~~C~~~i~ik   52 (259)
                      +||.|+..|++.
T Consensus         4 ~CP~CG~~iev~   15 (54)
T TIGR01206         4 ECPDCGAEIELE   15 (54)
T ss_pred             CCCCCCCEEecC
Confidence            455555555553


No 43 
>PF01396 zf-C4_Topoisom:  Topoisomerase DNA binding C4 zinc finger;  InterPro: IPR013498 DNA topoisomerases regulate the number of topological links between two DNA strands (i.e. change the number of superhelical turns) by catalysing transient single- or double-strand breaks, crossing the strands through one another, then resealing the breaks []. These enzymes have several functions: to remove DNA supercoils during transcription and DNA replication; for strand breakage during recombination; for chromosome condensation; and to disentangle intertwined DNA during mitosis [, ]. DNA topoisomerases are divided into two classes: type I enzymes (5.99.1.2 from EC; topoisomerases I, III and V) break single-strand DNA, and type II enzymes (5.99.1.3 from EC; topoisomerases II, IV and VI) break double-strand DNA []. Type I topoisomerases are ATP-independent enzymes (except for reverse gyrase), and can be subdivided according to their structure and reaction mechanisms: type IA (bacterial and archaeal topoisomerase I, topoisomerase III and reverse gyrase) and type IB (eukaryotic topoisomerase I and topoisomerase V). These enzymes are primarily responsible for relaxing positively and/or negatively supercoiled DNA, except for reverse gyrase, which can introduce positive supercoils into DNA.  This entry represents the zinc-finger domain found in type IA topoisomerases, including bacterial and archaeal topoisomerase I and III enzymes, and in eukaryotic topoisomerase III enzymes. Escherichia coli topoisomerase I proteins contain five copies of a zinc-ribbon-like domain at their C terminus, two of which have lost their cysteine residues and are therefore probably not able to bind zinc []. This domain is still considered to be a member of the zinc-ribbon superfamily despite not being able to bind zinc. More information about this protein can be found at Protein of the Month: DNA Topoisomerase [].; GO: 0003677 DNA binding, 0003916 DNA topoisomerase activity, 0006265 DNA topological change, 0005694 chromosome
Probab=42.29  E-value=23  Score=23.51  Aligned_cols=18  Identities=28%  Similarity=0.525  Sum_probs=15.9

Q ss_pred             EEcCCCCceeEEecCCCC
Q 025008           40 MKSPCCKHQIVIQTDPKN   57 (259)
Q Consensus        40 mkC~~C~~~i~ikTDPkn   57 (259)
                      .+|+.|++.+++++-...
T Consensus         2 ~~CP~Cg~~lv~r~~k~g   19 (39)
T PF01396_consen    2 EKCPKCGGPLVLRRGKKG   19 (39)
T ss_pred             cCCCCCCceeEEEECCCC
Confidence            369999999999998887


No 44 
>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete. This model represents the lysyl-tRNA synthetases that are class I amino-acyl tRNA synthetases. It includes archaeal and spirochete examples of the enzyme. All other known examples are class IIc amino-acyl tRNA synthetases and seem to form a separate orthologous set.
Probab=39.69  E-value=24  Score=35.90  Aligned_cols=38  Identities=18%  Similarity=0.567  Sum_probs=25.9

Q ss_pred             CCcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEE
Q 025008            1 MPFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVI   51 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~i   51 (259)
                      .||+..|..||..-..=|-||++. +| .|          .|. |+++.+.
T Consensus       165 ~P~~pic~~cGrv~~~~~~~~~~~-~v-~Y----------~c~-cG~~g~~  202 (515)
T TIGR00467       165 YPISVFCENCGRDTTTVNNYDNEY-SI-EY----------SCE-CGNQESV  202 (515)
T ss_pred             eeeeeecCCcCccCceEEEecCCc-eE-EE----------EcC-CCCEEEE
Confidence            399999999998755555677655 33 11          364 8877664


No 45 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=39.64  E-value=15  Score=22.22  Aligned_cols=17  Identities=24%  Similarity=0.810  Sum_probs=10.9

Q ss_pred             ceecCCCCccccccccc
Q 025008            4 NIWCGGCNSMIAKGVRF   20 (259)
Q Consensus         4 ~iwC~~C~~~I~kGvRF   20 (259)
                      .+.|..||..|..+-+|
T Consensus         2 ~~~Cp~Cg~~~~~~~~f   18 (26)
T PF13248_consen    2 EMFCPNCGAEIDPDAKF   18 (26)
T ss_pred             cCCCcccCCcCCccccc
Confidence            45677777766666554


No 46 
>PF14255 Cys_rich_CPXG:  Cysteine-rich CPXCG
Probab=39.07  E-value=27  Score=24.95  Aligned_cols=24  Identities=29%  Similarity=0.499  Sum_probs=16.2

Q ss_pred             EcCCCCceeEEecCCCCCCeeeec
Q 025008           41 KSPCCKHQIVIQTDPKNCEYVIIS   64 (259)
Q Consensus        41 kC~~C~~~i~ikTDPkn~dYvv~~   64 (259)
                      .||-|+.+|++--||...+-..++
T Consensus         2 ~CPyCge~~~~~iD~s~~~Q~yiE   25 (52)
T PF14255_consen    2 QCPYCGEPIEILIDPSAGDQEYIE   25 (52)
T ss_pred             CCCCCCCeeEEEEecCCCCeeEEe
Confidence            577788888777777766544443


No 47 
>PRK09628 oorB 2-oxoglutarate-acceptor oxidoreductase subunit OorB; Reviewed
Probab=38.44  E-value=14  Score=34.46  Aligned_cols=19  Identities=26%  Similarity=0.700  Sum_probs=12.8

Q ss_pred             ceecCCCCccccccccccc
Q 025008            4 NIWCGGCNSMIAKGVRFNA   22 (259)
Q Consensus         4 ~iwC~~C~~~I~kGvRFNA   22 (259)
                      ++||.||++.|--..=+.+
T Consensus        16 ~~~CpGCg~~i~~~~v~~a   34 (277)
T PRK09628         16 TLWCWGCGDGVILKSIIRA   34 (277)
T ss_pred             CCcCCCCCCchHHHHHHHH
Confidence            6899999975554444444


No 48 
>PF09723 Zn-ribbon_8:  Zinc ribbon domain;  InterPro: IPR013429  This entry represents a region of about 41 amino acids found in a number of small proteins in a wide range of bacteria. The region usually begins with the initiator Met and contains two CxxC motifs separated by 17 amino acids. One protein in this entry has been noted as a putative regulatory protein, designated FmdB []. Most proteins in this entry have a C-terminal region containing highly degenerate sequence.
Probab=37.71  E-value=31  Score=23.09  Aligned_cols=19  Identities=16%  Similarity=0.530  Sum_probs=14.8

Q ss_pred             eeeEEEEEEcCCCCceeEEec
Q 025008           33 TKIWSFTMKSPCCKHQIVIQT   53 (259)
Q Consensus        33 t~I~~F~mkC~~C~~~i~ikT   53 (259)
                      .|||.|  +|..|++.|++..
T Consensus         1 MP~Yey--~C~~Cg~~fe~~~   19 (42)
T PF09723_consen    1 MPIYEY--RCEECGHEFEVLQ   19 (42)
T ss_pred             CCCEEE--EeCCCCCEEEEEE
Confidence            367776  6889999999764


No 49 
>smart00659 RPOLCX RNA polymerase subunit CX. present in RNA polymerase I, II and III
Probab=37.27  E-value=31  Score=23.63  Aligned_cols=19  Identities=16%  Similarity=0.272  Sum_probs=15.9

Q ss_pred             EEEEcCCCCceeEEecCCC
Q 025008           38 FTMKSPCCKHQIVIQTDPK   56 (259)
Q Consensus        38 F~mkC~~C~~~i~ikTDPk   56 (259)
                      ..++|+.|++.|.++-=|.
T Consensus        18 ~~irC~~CG~rIlyK~R~~   36 (44)
T smart00659       18 DVVRCRECGYRILYKKRTK   36 (44)
T ss_pred             CceECCCCCceEEEEeCCC
Confidence            5689999999999987654


No 50 
>PHA02998 RNA polymerase subunit; Provisional
Probab=36.90  E-value=22  Score=31.88  Aligned_cols=54  Identities=24%  Similarity=0.411  Sum_probs=38.6

Q ss_pred             ccccccccceeecc---CceeeeeeEEEEEEcCCCCc----eeEEecC----CCCCCeeeecCcc
Q 025008           14 IAKGVRFNAEKKQV---GNYYSTKIWSFTMKSPCCKH----QIVIQTD----PKNCEYVIISGAQ   67 (259)
Q Consensus        14 I~kGvRFNAeKk~v---g~Y~st~I~~F~mkC~~C~~----~i~ikTD----Pkn~dYvv~~Gar   67 (259)
                      |.+||-||-+|-.-   +.||.+-==.-..+|+.|++    ++.+||-    |...-|.|..-+.
T Consensus       115 v~~~veydid~~~d~~y~~yfnvlpkkt~v~CPkCg~~~A~f~qlQTRSADEPmT~FYkC~~CG~  179 (195)
T PHA02998        115 IKKGVEYDIDKIPDVDYDDYFNVLDEKYNTPCPNCKSKNTTPMMIQTRAADEPPLVRHACRDCKK  179 (195)
T ss_pred             HhcCCccchhhcccccchhheeccCcccCCCCCCCCCCceEEEEEeeccCCCCceEEEEcCCCCC
Confidence            67999999988653   47888533225589999997    4667887    5567788765443


No 51 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=36.88  E-value=34  Score=22.24  Aligned_cols=16  Identities=19%  Similarity=0.445  Sum_probs=9.9

Q ss_pred             cCCCCceeEEecCCCC
Q 025008           42 SPCCKHQIVIQTDPKN   57 (259)
Q Consensus        42 C~~C~~~i~ikTDPkn   57 (259)
                      |+.|+|-+..+.|..+
T Consensus         4 Cp~C~nlL~p~~~~~~   19 (35)
T PF02150_consen    4 CPECGNLLYPKEDKEK   19 (35)
T ss_dssp             ETTTTSBEEEEEETTT
T ss_pred             CCCCCccceEcCCCcc
Confidence            6666666666666554


No 52 
>cd02338 ZZ_PCMF_like Zinc finger, ZZ type. Zinc finger present in potassium channel modulatory factor (PCMF) 1  and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Human potassium channel modulatory factor 1 or FIGC has been shown to possess intrinsic E3 ubiquitin ligase activity and to promote ubiquitination.
Probab=35.61  E-value=16  Score=25.39  Aligned_cols=13  Identities=15%  Similarity=0.115  Sum_probs=7.6

Q ss_pred             eeEEEEEEcCCCC
Q 025008           34 KIWSFTMKSPCCK   46 (259)
Q Consensus        34 ~I~~F~mkC~~C~   46 (259)
                      ||..++++|..|.
T Consensus        10 ~i~g~R~~C~~C~   22 (49)
T cd02338          10 NFTGRRYKCLICY   22 (49)
T ss_pred             CcEEeeEEeCCCC
Confidence            4445566677664


No 53 
>cd02339 ZZ_Mind_bomb Zinc finger, ZZ type. Zinc finger present in Drosophila Mind bomb (D-mib) and related proteins. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding. Mind bomb is an E3 ubiqitin ligase that has been shown to regulate signaling by the Notch ligand Delta in Drosophila melanogaster.
Probab=35.21  E-value=18  Score=24.87  Aligned_cols=17  Identities=29%  Similarity=0.686  Sum_probs=11.1

Q ss_pred             eecCCCCcccccccccc
Q 025008            5 IWCGGCNSMIAKGVRFN   21 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFN   21 (259)
                      |.|.+|+...-.|+||-
T Consensus         1 i~Cd~C~~~~i~G~Ryk   17 (45)
T cd02339           1 IICDTCRKQGIIGIRWK   17 (45)
T ss_pred             CCCCCCCCCCcccCeEE
Confidence            57888886555565553


No 54 
>PF14205 Cys_rich_KTR:  Cysteine-rich KTR
Probab=35.21  E-value=39  Score=24.63  Aligned_cols=38  Identities=26%  Similarity=0.506  Sum_probs=28.1

Q ss_pred             eecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEec
Q 025008            5 IWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQT   53 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ikT   53 (259)
                      +.|-.||+           |..+.-.-.|-+--|-..||.|..+..|.-
T Consensus         5 i~CP~Cgn-----------KTR~kir~DT~LkNfPlyCpKCK~EtlI~v   42 (55)
T PF14205_consen    5 ILCPICGN-----------KTRLKIREDTVLKNFPLYCPKCKQETLIDV   42 (55)
T ss_pred             EECCCCCC-----------ccceeeecCceeccccccCCCCCceEEEEe
Confidence            56888876           444545556778888899999999877743


No 55 
>PF10058 DUF2296:  Predicted integral membrane metal-binding protein (DUF2296);  InterPro: IPR019273  This domain, found mainly in the eukaryotic lunapark proteins, has no known function []. 
Probab=34.89  E-value=31  Score=24.68  Aligned_cols=34  Identities=18%  Similarity=0.398  Sum_probs=21.9

Q ss_pred             CcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCce
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQ   48 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~   48 (259)
                      .|.+.|..|..|-|+--     ++        ..-....+|+.|+..
T Consensus        20 r~aLIC~~C~~hNGla~-----~~--------~~~~i~y~C~~Cg~~   53 (54)
T PF10058_consen   20 RYALICSKCFSHNGLAP-----KE--------EFEEIQYRCPYCGAL   53 (54)
T ss_pred             ceeEECcccchhhcccc-----cc--------cCCceEEEcCCCCCc
Confidence            47889999998877643     11        111235679999753


No 56 
>PF06107 DUF951:  Bacterial protein of unknown function (DUF951);  InterPro: IPR009296 This family consists of several short hypothetical bacterial proteins of unknown function.
Probab=34.87  E-value=34  Score=25.09  Aligned_cols=14  Identities=29%  Similarity=0.589  Sum_probs=11.9

Q ss_pred             EEEEcCCCCceeEE
Q 025008           38 FTMKSPCCKHQIVI   51 (259)
Q Consensus        38 F~mkC~~C~~~i~i   51 (259)
                      |.++|..|+..|.+
T Consensus        30 ikikC~gCg~~iml   43 (57)
T PF06107_consen   30 IKIKCLGCGRQIML   43 (57)
T ss_pred             EEEEECCCCCEEEE
Confidence            78889999988876


No 57 
>PF06750 DiS_P_DiS:  Bacterial Peptidase A24 N-terminal domain;  InterPro: IPR010627 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families. Clans are groups of families for which there is evidence of common ancestry based on a common structural fold:  Each clan is identified with two letters, the first representing the catalytic type of the families included in the clan (with the letter 'P' being used for a clan containing families of more than one of the catalytic types serine, threonine and cysteine). Some families cannot yet be assigned to clans, and when a formal assignment is required, such a family is described as belonging to clan A-, C-, M-, N-, S-, T- or U-, according to the catalytic type. Some clans are divided into subclans because there is evidence of a very ancient divergence within the clan, for example MA(E), the gluzincins, and MA(M), the metzincins. Peptidase families are grouped by their catalytic type, the first character representing the catalytic type: A, aspartic; C, cysteine; G, glutamic acid; M, metallo; N, asparagine; S, serine; T, threonine; and U, unknown. The serine, threonine and cysteine peptidases utilise the amino acid as a nucleophile and form an acyl intermediate - these peptidases can also readily act as transferases. In the case of aspartic, glutamic and metallopeptidases, the nucleophile is an activated water molecule. In the case of the asparagine endopeptidases, the nucleophile is asparagine and all are self-processing endopeptidases.   In many instances the structural protein fold that characterises the clan or family may have lost its catalytic activity, yet retain its function in protein recognition and binding.  Aspartic endopeptidases 3.4.23. from EC of vertebrate, fungal and retroviral origin have been characterised []. More recently, aspartic endopeptidases associated with the processing of bacterial type 4 prepilin [] and archaean preflagellin have been described [, ]. Structurally, aspartic endopeptidases are bilobal enzymes, each lobe contributing a catalytic Asp residue, with an extended active site cleft localised between the two lobes of the molecule. One lobe has probably evolved from the other through a gene duplication event in the distant past. In modern-day enzymes, although the three-dimensional structures are very similar, the amino acid sequences are more divergent, except for the catalytic site motif, which is very conserved. The presence and position of disulphide bridges are other conserved features of aspartic peptidases. All or most aspartate peptidases are endopeptidases. These enzymes have been assigned into clans (proteins which are evolutionary related), and further sub-divided into families, largely on the basis of their tertiary structure. This domain is found at the N terminus of bacterial aspartic peptidases belonging to MEROPS peptidase family A24 (clan AD), subfamily A24A (type IV prepilin peptidase, IPR000045 from INTERPRO). It's function has not been specifically determined; however some of the family have been characterised as bifunctional [], and this domain may contain the N-methylation activity. The domain consists of an intracellular region between a pair of transmembrane domains. This intracellular region contains an invariant proline and four conserved cysteines. These Cys residues are arranged in a two-pair motif, with the Cys residues of a pair separated (usually) by 2 aa and with each pair separated by 21 largely hydrophilic residues (C-X-X-C...X21...C-X-X-C); they have been shown to be essential to the overall function of the enzyme [, ].   The bifunctional enzyme prepilin peptidase (PilD) from Pseudomonas aeruginosa is a key determinant in both type-IV pilus biogenesis and extracellular protein secretion, in its roles as a leader peptidase and methyl transferase (MTase). It is responsible for endopeptidic cleavage of the unique leader peptides that characterise type-IV pilin precursors, as well as proteins with homologous leader sequences that are essential components of the general secretion pathway found in a variety of Gram-negative pathogens. Following removal of the leader peptides, the same enzyme is responsible for the second posttranslational modification that characterises the type-IV pilins and their homologues, namely N-methylation of the newly exposed N-terminal amino acid residue []. 
Probab=34.52  E-value=6.7  Score=30.77  Aligned_cols=33  Identities=18%  Similarity=0.314  Sum_probs=24.4

Q ss_pred             ecCCCCccccccccccceeeccCceeeeeeEEE---EEEcCCCCceeEE
Q 025008            6 WCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSF---TMKSPCCKHQIVI   51 (259)
Q Consensus         6 wC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F---~mkC~~C~~~i~i   51 (259)
                      .|.+|+..             +.-|.-+||++|   +-||..|...|.+
T Consensus        35 ~C~~C~~~-------------L~~~~lIPi~S~l~lrGrCr~C~~~I~~   70 (92)
T PF06750_consen   35 HCPHCGHP-------------LSWWDLIPILSYLLLRGRCRYCGAPIPP   70 (92)
T ss_pred             cCcCCCCc-------------CcccccchHHHHHHhCCCCcccCCCCCh
Confidence            47777654             346677899887   5679999998854


No 58 
>COG4416 Com Mu-like prophage protein Com [General function prediction only]
Probab=34.19  E-value=25  Score=25.77  Aligned_cols=44  Identities=25%  Similarity=0.489  Sum_probs=27.7

Q ss_pred             CcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCC--ceeEEecCCCCCCeee
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCK--HQIVIQTDPKNCEYVI   62 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~--~~i~ikTDPkn~dYvv   62 (259)
                      -=+|+|..|+..+.+..        ...|+       ..|||.|.  |+|.|+  -+++.|+-
T Consensus         2 ~~tiRC~~CnKlLa~a~--------~~~yl-------e~KCPrCK~vN~~~~~--~e~~t~~~   47 (60)
T COG4416           2 MQTIRCAKCNKLLAEAE--------GQAYL-------EKKCPRCKEVNEFYIK--EEATTQIH   47 (60)
T ss_pred             ceeeehHHHhHHHHhcc--------cceee-------eecCCccceeeeeecc--cccchhhh
Confidence            34799999998765421        01354       57899997  455555  45666653


No 59 
>PRK05778 2-oxoglutarate ferredoxin oxidoreductase subunit beta; Validated
Probab=34.11  E-value=15  Score=34.67  Aligned_cols=13  Identities=31%  Similarity=0.963  Sum_probs=10.1

Q ss_pred             ceecCCCCccccc
Q 025008            4 NIWCGGCNSMIAK   16 (259)
Q Consensus         4 ~iwC~~C~~~I~k   16 (259)
                      ++||.|||+.+-.
T Consensus        18 ~~~CpGCg~~~i~   30 (301)
T PRK05778         18 TTWCPGCGNFGIL   30 (301)
T ss_pred             CCCCCCCCChHHH
Confidence            4799999986543


No 60 
>KOG2846 consensus Predicted membrane protein [Function unknown]
Probab=33.44  E-value=21  Score=34.43  Aligned_cols=42  Identities=19%  Similarity=0.532  Sum_probs=29.0

Q ss_pred             cceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEecCCCC
Q 025008            3 FNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQTDPKN   57 (259)
Q Consensus         3 F~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ikTDPkn   57 (259)
                      |.++|..|..|=|+-.+     +.- .|-       .+.|+.|.....=+-+|+|
T Consensus       219 yALIC~~C~~HNGla~~-----ee~-~yi-------~F~C~~Cn~LN~~~k~~e~  260 (328)
T KOG2846|consen  219 YALICSQCHHHNGLARK-----EEY-EYI-------TFRCPHCNALNPAKKSPEN  260 (328)
T ss_pred             hhhcchhhccccCcCCh-----hhc-Cce-------EEECccccccCCCcCCccc
Confidence            67899999999887654     111 111       3679999998876666555


No 61 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=32.66  E-value=24  Score=26.44  Aligned_cols=19  Identities=32%  Similarity=0.725  Sum_probs=14.8

Q ss_pred             cCCCCce--------eEEecCCCCCCe
Q 025008           42 SPCCKHQ--------IVIQTDPKNCEY   60 (259)
Q Consensus        42 C~~C~~~--------i~ikTDPkn~dY   60 (259)
                      ||.|+..        +.|-+||++++-
T Consensus        21 CP~Cgs~~~te~W~G~~iIidpe~SeI   47 (64)
T COG2093          21 CPVCGSTDLTEEWFGLLIIIDPEKSEI   47 (64)
T ss_pred             CCCCCCcccchhhccEEEEEcCcHHHH
Confidence            8999887        667888888653


No 62 
>PF00569 ZZ:  Zinc finger, ZZ type;  InterPro: IPR000433 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents ZZ-type zinc finger domains, named because of their ability to bind two zinc ions []. These domains contain 4-6 Cys residues that participate in zinc binding (plus additional Ser/His residues), including a Cys-X2-Cys motif found in other zinc finger domains. These zinc fingers are thought to be involved in protein-protein interactions. The structure of the ZZ domain shows that it belongs to the family of cross-brace zinc finger motifs that include the PHD, RING, and FYVE domains []. ZZ-type zinc finger domains are found in:   Transcription factors P300 and CBP. Plant proteins involved in light responses, such as Hrb1. E3 ubiquitin ligases MEX and MIB2 (6.3.2 from EC). Dystrophin and its homologues.   Single copies of the ZZ zinc finger occur in the transcriptional adaptor/coactivator proteins P300, in cAMP response element-binding protein (CREB)-binding protein (CBP) and ADA2. CBP provides several binding sites for transcriptional coactivators. The site of interaction with the tumour suppressor protein p53 and the oncoprotein E1A with CBP/P300 is a Cys-rich region that incorporates two zinc-binding motifs: ZZ-type and TAZ2-type. The ZZ-type zinc finger of CBP contains two twisted anti-parallel beta-sheets and a short alpha-helix, and binds two zinc ions []. One zinc ion is coordinated by four cysteine residues via 2 Cys-X2-Cys motifs, and the third zinc ion via a third Cys-X-Cys motif and a His-X-His motif. The first zinc cluster is strictly conserved, whereas the second zinc cluster displays variability in the position of the two His residues. In Arabidopsis thaliana (Mouse-ear cress), the hypersensitive to red and blue 1 (Hrb1) protein, which regulating both red and blue light responses, contains a ZZ-type zinc finger domain [].  ZZ-type zinc finger domains have also been identified in the testis-specific E3 ubiquitin ligase MEX that promotes death receptor-induced apoptosis []. MEX has four putative zinc finger domains: one ZZ-type, one SWIM-type and two RING-type. The region containing the ZZ-type and RING-type zinc fingers is required for interaction with UbcH5a and MEX self-association, whereas the SWIM domain was critical for MEX ubiquitination. In addition, the Cys-rich domains of dystrophin, utrophin and an 87kDa post-synaptic protein contain a ZZ-type zinc finger with high sequence identity to P300/CBP ZZ-type zinc fingers. In dystrophin and utrophin, the ZZ-type zinc finger lies between a WW domain (flanked by and EF hand) and the C-terminal coiled-coil domain. Dystrophin is thought to act as a link between the actin cytoskeleton and the extracellular matrix, and perturbations of the dystrophin-associated complex, for example, between dystrophin and the transmembrane glycoprotein beta-dystroglycan, may lead to muscular dystrophy. Dystrophin and its autosomal homologue utrophin interact with beta-dystroglycan via their C-terminal regions, which are comprised of a WW domain, an EF hand domain and a ZZ-type zinc finger domain []. The WW domain is the primary site of interaction between dystrophin or utrophin and dystroglycan, while the EF hand and ZZ-type zinc finger domains stabilise and strengthen this interaction.  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 1TOT_A 2DIP_A 2FC7_A 2E5R_A.
Probab=32.22  E-value=22  Score=24.16  Aligned_cols=20  Identities=30%  Similarity=0.679  Sum_probs=11.8

Q ss_pred             cceecCCCCccccccccccc
Q 025008            3 FNIWCGGCNSMIAKGVRFNA   22 (259)
Q Consensus         3 F~iwC~~C~~~I~kGvRFNA   22 (259)
                      +.+.|.+|+...-.|+||--
T Consensus         3 ~~~~C~~C~~~~i~g~Ry~C   22 (46)
T PF00569_consen    3 HGYTCDGCGTDPIIGVRYHC   22 (46)
T ss_dssp             SSCE-SSS-SSSEESSEEEE
T ss_pred             CCeECcCCCCCcCcCCeEEC
Confidence            46889999875445666643


No 63 
>cd00674 LysRS_core_class_I catalytic core domain of  class I lysyl tRNA synthetase. Class I lysyl tRNA synthetase (LysRS) catalytic core domain. This class I enzyme is a monomer which aminoacylates the 2'-OH of the nucleotide at the 3' of the appropriate tRNA. The core domain is based on the Rossman fold and is responsible for the ATP-dependent formation of the enzyme bound aminoacyl-adenylate. It contains the characteristic class I HIGH and KMSKS motifs, which are involved in ATP binding. The class I LysRS is found only in archaea and some bacteria and has evolved separately from class II LysRS, as the two do not share structural or sequence similarity.
Probab=32.00  E-value=36  Score=32.96  Aligned_cols=38  Identities=24%  Similarity=0.595  Sum_probs=22.9

Q ss_pred             CCcceecCCCCcccccc-ccccceeeccCceeeeeeEEEEEEcCCCCceeEE
Q 025008            1 MPFNIWCGGCNSMIAKG-VRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVI   51 (259)
Q Consensus         1 mPF~iwC~~C~~~I~kG-vRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~i   51 (259)
                      .||+..|..|| -|.-- +-||.+..+|         .|  .|. |+++.+.
T Consensus       166 ~P~~p~c~~cg-~~~~~v~~~d~~~~~v---------~y--~c~-cG~~g~~  204 (353)
T cd00674         166 YPFMPYCEKCG-KDTTTVEAYDAKAGTV---------TY--KCE-CGHEETV  204 (353)
T ss_pred             eeeeeecCCcC-cceeEEEEEeCCCCeE---------EE--EcC-CCCEEEE
Confidence            39999999999 33322 2456555444         12  463 7776654


No 64 
>COG1996 RPC10 DNA-directed RNA polymerase, subunit RPC10 (contains C4-type Zn-finger) [Transcription]
Probab=31.69  E-value=42  Score=23.82  Aligned_cols=19  Identities=26%  Similarity=0.730  Sum_probs=15.6

Q ss_pred             EEEcCCCCceeEEecCCCC
Q 025008           39 TMKSPCCKHQIVIQTDPKN   57 (259)
Q Consensus        39 ~mkC~~C~~~i~ikTDPkn   57 (259)
                      .++|+.|+..|-|+-=|.-
T Consensus        24 ~irCp~Cg~rIl~K~R~~~   42 (49)
T COG1996          24 GIRCPYCGSRILVKERPKV   42 (49)
T ss_pred             ceeCCCCCcEEEEeccCCc
Confidence            3689999999999876654


No 65 
>COG2816 NPY1 NTP pyrophosphohydrolases containing a Zn-finger, probably nucleic-acid-binding [DNA replication, recombination, and repair]
Probab=31.30  E-value=32  Score=32.51  Aligned_cols=33  Identities=18%  Similarity=0.392  Sum_probs=24.3

Q ss_pred             EEEEcCCCCceeEEecCCC------CCCeeeecCcccCC
Q 025008           38 FTMKSPCCKHQIVIQTDPK------NCEYVIISGAQRKT   70 (259)
Q Consensus        38 F~mkC~~C~~~i~ikTDPk------n~dYvv~~GarR~~   70 (259)
                      ..+-|+.|++.+-=+|||-      +.++++.-|-.|..
T Consensus       128 ~~~~C~~cg~~~fPR~dP~vIv~v~~~~~ilLa~~~~h~  166 (279)
T COG2816         128 WARVCPKCGHEHFPRIDPCVIVAVIRGDEILLARHPRHF  166 (279)
T ss_pred             eeeeCCCCCCccCCCCCCeEEEEEecCCceeecCCCCCC
Confidence            4578999999999999994      45555555555544


No 66 
>PF01485 IBR:  IBR domain;  InterPro: IPR002867 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a cysteine-rich (C6HC) zinc finger domain that is present in Triad1, and which is conserved in other proteins encoded by various eukaryotes. The C6HC consensus pattern is:  C-x(4)-C-x(14-30)-C-x(1-4)-C-x(4)-C-x(2)-C-x(4)-H-x(4)-C  The C6HC zinc finger motif is the fourth family member of the zinc-binding RING, LIM, and LAP/PHD fingers. Strikingly, in most of the proteins the C6HC domain is flanked by two RING finger structures IPR001841 from INTERPRO. The novel C6HC motif has been called DRIL (double RING finger linked). The strong conservation of the larger tripartite TRIAD (twoRING fingers and DRIL) structure indicates that the three subdomains are functionally linked and identifies a novel class of proteins []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2CT7_A 1WD2_A 2JMO_A 1WIM_A.
Probab=31.19  E-value=28  Score=23.93  Aligned_cols=18  Identities=33%  Similarity=0.789  Sum_probs=6.2

Q ss_pred             eecCC--CCccccccccccc
Q 025008            5 IWCGG--CNSMIAKGVRFNA   22 (259)
Q Consensus         5 iwC~~--C~~~I~kGvRFNA   22 (259)
                      .||.+  |+..|.....-+.
T Consensus        19 ~~Cp~~~C~~~~~~~~~~~~   38 (64)
T PF01485_consen   19 RWCPNPDCEYIIEKDDGCNS   38 (64)
T ss_dssp             C--TTSST---ECS-SSTTS
T ss_pred             cCCCCCCCcccEEecCCCCC
Confidence            46655  7666655544444


No 67 
>PF04606 Ogr_Delta:  Ogr/Delta-like zinc finger;  InterPro: IPR007684 This entry is represented by Bacteriophage P2, Ogr. The characteristics of the protein distribution suggest prophage matches in addition to the phage matches. This is a viral family of phage zinc-binding transcriptional activators, which also contains cryptic members in some bacterial genomes []. The P4 phage delta protein contains two such domains attached covalently, while the P2 phage Ogr proteins possess one domain but function as dimers. All the members of this family have the following consensus sequence: C-X(2)-C-X(3)-A-(X)2-R-X(15)-C-X(4)-C-X(3)-F [].; GO: 0006355 regulation of transcription, DNA-dependent
Probab=30.41  E-value=30  Score=23.67  Aligned_cols=19  Identities=21%  Similarity=0.417  Sum_probs=15.5

Q ss_pred             EcCCCCceeEEecCCCCCC
Q 025008           41 KSPCCKHQIVIQTDPKNCE   59 (259)
Q Consensus        41 kC~~C~~~i~ikTDPkn~d   59 (259)
                      +||.|++...|+|-..-++
T Consensus         1 ~CP~Cg~~a~ir~S~~~s~   19 (47)
T PF04606_consen    1 RCPHCGSKARIRTSRQLSP   19 (47)
T ss_pred             CcCCCCCeeEEEEchhhCc
Confidence            5999999999998766544


No 68 
>PF05864 Chordopox_RPO7:  Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide (RPO7);  InterPro: IPR008448 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. This family consists of several Chordopoxvirus DNA-directed RNA polymerase 7 kDa polypeptide sequences. DNA-dependent RNA polymerase catalyses the transcription of DNA into RNA [].; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent
Probab=30.19  E-value=23  Score=26.16  Aligned_cols=15  Identities=27%  Similarity=0.751  Sum_probs=11.9

Q ss_pred             CCcceecCCCCcccc
Q 025008            1 MPFNIWCGGCNSMIA   15 (259)
Q Consensus         1 mPF~iwC~~C~~~I~   15 (259)
                      |-|.+.|.+||.-|.
T Consensus         1 MVf~lvCSTCGrDlS   15 (63)
T PF05864_consen    1 MVFQLVCSTCGRDLS   15 (63)
T ss_pred             CeeeeeecccCCcch
Confidence            678899999986554


No 69 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=29.71  E-value=31  Score=23.26  Aligned_cols=10  Identities=30%  Similarity=1.049  Sum_probs=6.3

Q ss_pred             ecCCCCcccc
Q 025008            6 WCGGCNSMIA   15 (259)
Q Consensus         6 wC~~C~~~I~   15 (259)
                      .|..||+.++
T Consensus         2 FCp~Cg~~l~   11 (52)
T smart00661        2 FCPKCGNMLI   11 (52)
T ss_pred             CCCCCCCccc
Confidence            3777777554


No 70 
>PRK11869 2-oxoacid ferredoxin oxidoreductase subunit beta; Provisional
Probab=28.73  E-value=20  Score=33.57  Aligned_cols=11  Identities=36%  Similarity=1.120  Sum_probs=9.0

Q ss_pred             ceecCCCCccc
Q 025008            4 NIWCGGCNSMI   14 (259)
Q Consensus         4 ~iwC~~C~~~I   14 (259)
                      ++||.|||+.+
T Consensus         8 ~~~CpGCg~~~   18 (280)
T PRK11869          8 IAWCPGCGNFG   18 (280)
T ss_pred             CCCCcCCCCHH
Confidence            57999999853


No 71 
>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones]
Probab=28.68  E-value=76  Score=31.23  Aligned_cols=53  Identities=25%  Similarity=0.479  Sum_probs=33.2

Q ss_pred             CcceecCCCCccccccccccceeecc------Cceee---eeeEEEEEEcCCCCceeEEecCCCC
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQV------GNYYS---TKIWSFTMKSPCCKHQIVIQTDPKN   57 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~v------g~Y~s---t~I~~F~mkC~~C~~~i~ikTDPkn   57 (259)
                      |-.+-|.+|+-.   |.+-.+.-++-      |....   |-+|++...|+.|.+.=.|-.||=.
T Consensus       140 ~~~~~C~~C~Gs---Gak~gt~~~tC~tC~G~G~v~~~~~~g~~~~~~~C~~C~G~G~~i~~pC~  201 (371)
T COG0484         140 TRSVTCSTCHGS---GAKPGTDPKTCPTCNGSGQVRTVQRTGFFSFQQTCPTCNGTGKIIKDPCG  201 (371)
T ss_pred             ceeeECCcCCCC---CCCCCCCCCcCCCCCCcCeEEEEEeeeEEEEEEECCCCccceeECCCCCC
Confidence            556778888633   44444322222      11221   2678999999999998888888744


No 72 
>PRK09678 DNA-binding transcriptional regulator; Provisional
Probab=28.53  E-value=29  Score=26.40  Aligned_cols=16  Identities=25%  Similarity=0.567  Sum_probs=13.4

Q ss_pred             EEcCCCCceeEEecCC
Q 025008           40 MKSPCCKHQIVIQTDP   55 (259)
Q Consensus        40 mkC~~C~~~i~ikTDP   55 (259)
                      |+||.|++.-.|+|-=
T Consensus         2 m~CP~Cg~~a~irtSr   17 (72)
T PRK09678          2 FHCPLCQHAAHARTSR   17 (72)
T ss_pred             ccCCCCCCccEEEECh
Confidence            8999999999887643


No 73 
>COG5134 Uncharacterized conserved protein [Function unknown]
Probab=28.02  E-value=22  Score=32.76  Aligned_cols=13  Identities=23%  Similarity=0.567  Sum_probs=12.1

Q ss_pred             EEEEcCCCCceeE
Q 025008           38 FTMKSPCCKHQIV   50 (259)
Q Consensus        38 F~mkC~~C~~~i~   50 (259)
                      |.|+|-.|+++|-
T Consensus        41 F~~RCL~C~~YI~   53 (272)
T COG5134          41 FPVRCLNCENYIQ   53 (272)
T ss_pred             cceeecchhhhhh
Confidence            9999999999994


No 74 
>PF05207 zf-CSL:  CSL zinc finger;  InterPro: IPR007872 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents a probable zinc binding motif that contains four cysteines and may chelate zinc, known as the DPH-type after the diphthamide (DPH) biosynthesis protein in which it was first characterised, including the proteins DPH3 and DPH4. This domain is also found associated with N-terminal domain of heat shock protein DnaJ IPR001623 from INTERPRO domain.  Diphthamide is a unique post-translationally modified histidine residue found only in translation elongation factor 2 (eEF-2). It is conserved from archaea to humans and serves as the target for diphteria toxin and Pseudomonas exotoxin A. These two toxins catalyse the transfer of ADP-ribose to diphtamide on eEF-2, thus inactivating eEF-2, halting cellular protein synthesis, and causing cell death []. The biosynthesis of diphtamide is dependent on at least five proteins, DPH1 to -5, and a still unidentified amidating enzyme. DPH3 and DPH4 share a conserved region, which encode a putative zinc finger, the DPH-type or CSL-type (after the conserved motif of the final cysteine) zinc finger [, ]. The function of this motif is unknown. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2L6L_A 1WGE_A 2JR7_A 1YOP_A 1YWS_A.
Probab=27.72  E-value=52  Score=23.43  Aligned_cols=15  Identities=13%  Similarity=0.372  Sum_probs=12.4

Q ss_pred             EEEEEcCCCCceeEEe
Q 025008           37 SFTMKSPCCKHQIVIQ   52 (259)
Q Consensus        37 ~F~mkC~~C~~~i~ik   52 (259)
                      .|++.| +|++.|.|-
T Consensus        16 ~~~y~C-RCG~~f~i~   30 (55)
T PF05207_consen   16 VYSYPC-RCGGEFEIS   30 (55)
T ss_dssp             EEEEEE-TTSSEEEEE
T ss_pred             EEEEcC-CCCCEEEEc
Confidence            388899 999998874


No 75 
>PF01258 zf-dskA_traR:  Prokaryotic dksA/traR C4-type zinc finger;  InterPro: IPR000962 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents domains identified in zinc finger-containing members of the DksA/TraR family. DksA is a critical component of the rRNA transcription initiation machinery that potentiates the regulation of rRNA promoters by ppGpp and the initiating NTP. In delta-dksA mutants, rRNA promoters are unresponsive to changes in amino acid availability, growth rate, or growth phase. In vitro, DksA binds to RNAP, reduces open complex lifetime, inhibits rRNA promoter activity, and amplifies effects of ppGpp and the initiating NTP on rRNA transcription [, ]. The dksA gene product suppresses the temperature-sensitive growth and filamentation of a dnaK deletion mutant of Escherichia coli. Gene knockout [] and deletion [] experiments have shown the gene to be non-essential, mutations causing a mild sensitivity to UV light, but not affecting DNA recombination []. In Pseudomonas aeruginosa, dksA is a novel regulator involved in the post-transcriptional control of extracellular virulence factor production [].  The proteins contain a C-terminal region thought to fold into a 4-cysteine zinc finger. Other proteins found to contain a similar zinc finger domain include:  the traR gene products encoded on the E. coli F and R100 plasmids [, ]  the traR gene products encoded on Salmonella spp. plasmids pED208 and pSLT  the dnaK suppressor  hypothetical proteins from bacteria and bacteriophage  FHL4, LIM proteins from Homo sapiens (Human) and Mus musculus (Mouse) []  More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding; PDB: 2GVI_A 2KQ9_A 2KGO_A 1TJL_I.
Probab=27.30  E-value=30  Score=22.20  Aligned_cols=14  Identities=29%  Similarity=0.826  Sum_probs=8.1

Q ss_pred             cceecCCCCcccccc
Q 025008            3 FNIWCGGCNSMIAKG   17 (259)
Q Consensus         3 F~iwC~~C~~~I~kG   17 (259)
                      |.+ |..||+.|...
T Consensus         3 yg~-C~~CGe~I~~~   16 (36)
T PF01258_consen    3 YGI-CEDCGEPIPEE   16 (36)
T ss_dssp             -SB--TTTSSBEEHH
T ss_pred             CCC-ccccCChHHHH
Confidence            444 88888877654


No 76 
>COG0846 SIR2 NAD-dependent protein deacetylases, SIR2 family [Transcription]
Probab=26.67  E-value=30  Score=32.01  Aligned_cols=16  Identities=13%  Similarity=0.314  Sum_probs=10.9

Q ss_pred             cceecCCCCccccccc
Q 025008            3 FNIWCGGCNSMIAKGV   18 (259)
Q Consensus         3 F~iwC~~C~~~I~kGv   18 (259)
                      +...|..|++-.+...
T Consensus       121 ~~~~C~~C~~~~~~~~  136 (250)
T COG0846         121 KRVRCSKCGNQYYDED  136 (250)
T ss_pred             eeeEeCCCcCccchhh
Confidence            4578999987655443


No 77 
>TIGR02177 PorB_KorB 2-oxoacid:acceptor oxidoreductase, beta subunit, pyruvate/2-ketoisovalerate family. Several related four-subunit enzymes may exist in the same species. This model describes a subfamily of beta subunits, representing mostly pyruvate and 2-ketoisovalerate specific enzymes.
Probab=26.47  E-value=25  Score=33.07  Aligned_cols=11  Identities=36%  Similarity=1.075  Sum_probs=8.8

Q ss_pred             ceecCCCCccc
Q 025008            4 NIWCGGCNSMI   14 (259)
Q Consensus         4 ~iwC~~C~~~I   14 (259)
                      .+||.|||+.+
T Consensus         1 ~~~CpGCg~~~   11 (287)
T TIGR02177         1 PDWCPGCGDFG   11 (287)
T ss_pred             CCcCCCCCChH
Confidence            37999999854


No 78 
>PF02146 SIR2:  Sir2 family;  InterPro: IPR003000 These sequences represent the Sirtuin (Sir2-related) family of NAD+-dependent deacetylases. This family of enzymes is broadly conserved from bacteria to humans. In yeast, Sir2 proteins form complexes with other proteins to silence chromatin by accessing histones and deacetylating them. Sir2 proteins have been proposed to play a role in silencing, chromosome stability and ageing []. The bacterial enzyme CobB, an homologue of Sir2, is a phosphoribosyltransferase []. An in vitro ADP ribosyltransferase activity has also been associated with human members of this family []. Sir2-like enzymes employ NAD+ as a cosubstrate in deacetylation reactions [] and catalyse a reaction in which the cleavage of NAD(+)and histone and/or protein deacetylation are coupled to the formation of O-acetyl-ADP-ribose, a novel metabolite. The dependence of the reaction on both NAD(+) and the generation of this potential second messenger offers new clues to understanding the function and regulation of nuclear, cytoplasmic and mitochondrial Sir2-like enzymes []. Silent Information Regulator protein of Saccharomyces cerevisiae (Sir2) is one of several factors critical for silencing at least three loci. Among them, it is unique because it silences the rDNA as well as the mating type loci and telomeres []. Sir2 interacts in a complex with itself and with Sir3 and Sir4, two proteins that are able to interact with nucleosomes. In addition Sir2 also interacts with ubiquitination factors and/or complexes [].  Homologues of Sir2 share a core domain including the GAG and NID motifs and a putative C4 Zinc finger. The regions containing these three conserved motifs are individually essential for Sir2 silencing function, as are the four cysteins []. In addition, the conserved residues HG next to the putative Zn finger have been shown to be essential for the ADP ribosyltransferase activity []. ; GO: 0008270 zinc ion binding, 0070403 NAD+ binding, 0006476 protein deacetylation; PDB: 1S5P_A 3PKI_E 3PKJ_F 3K35_A 1ICI_A 1M2K_A 1M2G_A 1M2N_B 1M2H_A 1M2J_A ....
Probab=26.34  E-value=29  Score=29.50  Aligned_cols=12  Identities=25%  Similarity=0.794  Sum_probs=8.1

Q ss_pred             cceecCCCCccc
Q 025008            3 FNIWCGGCNSMI   14 (259)
Q Consensus         3 F~iwC~~C~~~I   14 (259)
                      +.+.|..|+...
T Consensus       104 ~~~~C~~C~~~~  115 (178)
T PF02146_consen  104 FRLRCSKCGKEY  115 (178)
T ss_dssp             EEEEETTTSBEE
T ss_pred             ceeeecCCCccc
Confidence            456788887643


No 79 
>PHA03082 DNA-dependent RNA polymerase subunit; Provisional
Probab=26.08  E-value=30  Score=25.61  Aligned_cols=15  Identities=27%  Similarity=0.751  Sum_probs=11.7

Q ss_pred             CCcceecCCCCcccc
Q 025008            1 MPFNIWCGGCNSMIA   15 (259)
Q Consensus         1 mPF~iwC~~C~~~I~   15 (259)
                      |-|.+.|.+||.-|.
T Consensus         1 MVf~lVCsTCGrDlS   15 (63)
T PHA03082          1 MVFQLVCSTCGRDLS   15 (63)
T ss_pred             CeeeeeecccCcchh
Confidence            678899999986543


No 80 
>cd02344 ZZ_HERC2 Zinc finger, ZZ type. Zinc finger present in HERC2 and related proteins. HERC2 is a potential E3 ubiquitin protein ligase and/or guanine nucleotide exchange factor. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=26.05  E-value=32  Score=23.77  Aligned_cols=16  Identities=38%  Similarity=0.918  Sum_probs=9.1

Q ss_pred             eecCCCCccccccccc
Q 025008            5 IWCGGCNSMIAKGVRF   20 (259)
Q Consensus         5 iwC~~C~~~I~kGvRF   20 (259)
                      |.|.+|+...-.|.||
T Consensus         1 V~Cd~C~~~pI~G~Ry   16 (45)
T cd02344           1 VTCDGCQMFPINGPRF   16 (45)
T ss_pred             CCCCCCCCCCCccCeE
Confidence            4577777654444444


No 81 
>COG1779 C4-type Zn-finger protein [General function prediction only]
Probab=26.01  E-value=49  Score=29.93  Aligned_cols=27  Identities=11%  Similarity=0.269  Sum_probs=22.6

Q ss_pred             eeEEEEEEcCCCCceeEEecCCCCCCe
Q 025008           34 KIWSFTMKSPCCKHQIVIQTDPKNCEY   60 (259)
Q Consensus        34 ~I~~F~mkC~~C~~~i~ikTDPkn~dY   60 (259)
                      .++.|.|-||.|++.+...+=+-|.-|
T Consensus         9 ~~~~~~~~CPvCg~~l~~~~~~~~IPy   35 (201)
T COG1779           9 EEFETRIDCPVCGGTLKAHMYLYDIPY   35 (201)
T ss_pred             eeeeeeecCCcccceeeEEEeeecCCc
Confidence            578899999999999888887777555


No 82 
>cd02343 ZZ_EF Zinc finger, ZZ type. Zinc finger present in proteins with an EF_hand motif. The ZZ motif coordinates two zinc ions and most likely participates in ligand binding or molecular scaffolding.
Probab=25.99  E-value=33  Score=24.22  Aligned_cols=14  Identities=36%  Similarity=0.776  Sum_probs=8.3

Q ss_pred             eecCCCCcccccccc
Q 025008            5 IWCGGCNSMIAKGVR   19 (259)
Q Consensus         5 iwC~~C~~~I~kGvR   19 (259)
                      |-|.+|..+| .|+|
T Consensus         1 i~CdgC~~~~-~~~R   14 (48)
T cd02343           1 ISCDGCDEIA-PWHR   14 (48)
T ss_pred             CCCCCCCCcC-CCce
Confidence            4588887754 3433


No 83 
>smart00132 LIM Zinc-binding domain present in Lin-11, Isl-1, Mec-3. Zinc-binding domain family. Some LIM domains bind protein partners via tyrosine-containing motifs. LIM domains are found in many key regulators of developmental pathways.
Probab=25.95  E-value=27  Score=21.31  Aligned_cols=12  Identities=42%  Similarity=0.933  Sum_probs=9.9

Q ss_pred             ecCCCCcccccc
Q 025008            6 WCGGCNSMIAKG   17 (259)
Q Consensus         6 wC~~C~~~I~kG   17 (259)
                      .|.+|+..|.-+
T Consensus         1 ~C~~C~~~i~~~   12 (39)
T smart00132        1 KCAGCGKPIRGG   12 (39)
T ss_pred             CccccCCcccCC
Confidence            488999988776


No 84 
>KOG3497 consensus DNA-directed RNA polymerase, subunit RPB10 [Transcription]
Probab=25.65  E-value=31  Score=25.84  Aligned_cols=13  Identities=31%  Similarity=0.662  Sum_probs=7.5

Q ss_pred             cceecCCCCcccc
Q 025008            3 FNIWCGGCNSMIA   15 (259)
Q Consensus         3 F~iwC~~C~~~I~   15 (259)
                      .+|+|-+||.-||
T Consensus         3 iPiRCFtCGKvig   15 (69)
T KOG3497|consen    3 IPIRCFTCGKVIG   15 (69)
T ss_pred             eeeEeeecccccc
Confidence            4566666665553


No 85 
>PF00645 zf-PARP:  Poly(ADP-ribose) polymerase and DNA-Ligase Zn-finger region;  InterPro: IPR001510 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents PARP (Poly(ADP) polymerase) type zinc finger domains. NAD(+) ADP-ribosyltransferase(2.4.2.30 from EC) [, ] is a eukaryotic enzyme that catalyses the covalent attachment of ADP-ribose units from NAD(+) to various nuclear acceptor proteins. This post-translational modification of nuclear proteins is dependent on DNA. It appears to be involved in the regulation of various important cellular processes such as differentiation, proliferation and tumour transformation as well as in the regulation of the molecular events involved in the recovery of the cell from DNA damage. Structurally, NAD(+) ADP-ribosyltransferase consists of three distinct domains: an N-terminal zinc-dependent DNA-binding domain, a central automodification domain and a C-terminal NAD-binding domain. The DNA-binding region contains a pair of PARP-type zinc finger domains which have been shown to bind DNA in a zinc-dependent manner. The PARP-type zinc finger domains seem to bind specifically to single-stranded DNA and to act as a DNA nick sensor. DNA ligase III [] contains, in its N-terminal section, a single copy of a zinc finger highly similar to those of PARP. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0003677 DNA binding, 0008270 zinc ion binding; PDB: 1UW0_A 3OD8_D 3ODA_A 4AV1_A 2DMJ_A 4DQY_D 2L30_A 2CS2_A 2L31_A 3ODE_B ....
Probab=25.35  E-value=33  Score=25.52  Aligned_cols=13  Identities=54%  Similarity=0.994  Sum_probs=10.7

Q ss_pred             ecCCCCccccccc
Q 025008            6 WCGGCNSMIAKGV   18 (259)
Q Consensus         6 wC~~C~~~I~kGv   18 (259)
                      .|.+|+..|.+|.
T Consensus         9 ~Ck~C~~~I~kg~   21 (82)
T PF00645_consen    9 KCKGCKKKIAKGE   21 (82)
T ss_dssp             BETTTSCBE-TTS
T ss_pred             cCcccCCcCCCCC
Confidence            6999999999985


No 86 
>PF11793 FANCL_C:  FANCL C-terminal domain; PDB: 3K1L_A.
Probab=25.31  E-value=42  Score=24.82  Aligned_cols=16  Identities=19%  Similarity=0.285  Sum_probs=11.2

Q ss_pred             EEEcCCCCceeEEecC
Q 025008           39 TMKSPCCKHQIVIQTD   54 (259)
Q Consensus        39 ~mkC~~C~~~i~ikTD   54 (259)
                      .-.||.|..+|.+++|
T Consensus        55 ~G~CP~C~~~i~~~~~   70 (70)
T PF11793_consen   55 FGECPYCSSPISWSFS   70 (70)
T ss_dssp             EEE-TTT-SEEEGGG-
T ss_pred             ccCCcCCCCeeeEecC
Confidence            3579999999999886


No 87 
>PRK00423 tfb transcription initiation factor IIB; Reviewed
Probab=25.26  E-value=35  Score=32.03  Aligned_cols=26  Identities=19%  Similarity=0.181  Sum_probs=20.1

Q ss_pred             EEcCCCCceeEEecCCCCCCeeeecCc
Q 025008           40 MKSPCCKHQIVIQTDPKNCEYVIISGA   66 (259)
Q Consensus        40 mkC~~C~~~i~ikTDPkn~dYvv~~Ga   66 (259)
                      .+||.|+. -.|-+|.++.++||..=+
T Consensus        12 ~~Cp~Cg~-~~iv~d~~~Ge~vC~~CG   37 (310)
T PRK00423         12 LVCPECGS-DKLIYDYERGEIVCADCG   37 (310)
T ss_pred             CcCcCCCC-CCeeEECCCCeEeecccC
Confidence            47999997 478888998888876544


No 88 
>PF03604 DNA_RNApol_7kD:  DNA directed RNA polymerase, 7 kDa subunit;  InterPro: IPR006591 DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates. Each class of RNA polymerase is assembled from 9 to 15 different polypeptides. Rbp10 (RNA polymerase CX) is a domain found in RNA polymerase subunit 10; present in RNA polymerase I, II and III.; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 2PMZ_Z 3HKZ_X 2NVX_L 3S1Q_L 2JA6_L 3S17_L 3HOW_L 3HOV_L 3PO2_L 3HOZ_L ....
Probab=24.95  E-value=32  Score=22.18  Aligned_cols=13  Identities=31%  Similarity=0.881  Sum_probs=10.0

Q ss_pred             EEcCCCCceeEEe
Q 025008           40 MKSPCCKHQIVIQ   52 (259)
Q Consensus        40 mkC~~C~~~i~ik   52 (259)
                      ++|+.|+..|-++
T Consensus        18 irC~~CG~RIlyK   30 (32)
T PF03604_consen   18 IRCPECGHRILYK   30 (32)
T ss_dssp             SSBSSSS-SEEBE
T ss_pred             EECCcCCCeEEEe
Confidence            5899999988776


No 89 
>PF14353 CpXC:  CpXC protein
Probab=24.61  E-value=42  Score=27.10  Aligned_cols=45  Identities=20%  Similarity=0.466  Sum_probs=24.5

Q ss_pred             eecCCCCcccc--ccccccceeec--cCceeeeeeEEEEEEcCCCCceeEE
Q 025008            5 IWCGGCNSMIA--KGVRFNAEKKQ--VGNYYSTKIWSFTMKSPCCKHQIVI   51 (259)
Q Consensus         5 iwC~~C~~~I~--kGvRFNAeKk~--vg~Y~st~I~~F~mkC~~C~~~i~i   51 (259)
                      |-|.+|+....  -=.-.|+....  ...=++-.+  |.+.||.|+..+.+
T Consensus         2 itCP~C~~~~~~~v~~~I~~~~~p~l~e~il~g~l--~~~~CP~Cg~~~~~   50 (128)
T PF14353_consen    2 ITCPHCGHEFEFEVWTSINADEDPELKEKILDGSL--FSFTCPSCGHKFRL   50 (128)
T ss_pred             cCCCCCCCeeEEEEEeEEcCcCCHHHHHHHHcCCc--CEEECCCCCCceec
Confidence            67999986421  11344543221  111222222  45679999999986


No 90 
>PRK03954 ribonuclease P protein component 4; Validated
Probab=23.96  E-value=87  Score=26.07  Aligned_cols=44  Identities=20%  Similarity=0.362  Sum_probs=28.0

Q ss_pred             eecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEecC
Q 025008            5 IWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQTD   54 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ikTD   54 (259)
                      .+|..|+.++-=|+  |+.-+.-+.=++    .+.+.|..|+..--|-.+
T Consensus        65 ~~CK~C~t~LiPG~--n~~vRi~~~~~~----~vvitCl~CG~~kR~P~~  108 (121)
T PRK03954         65 RYCKRCHSFLVPGV--NARVRLRQKRMP----HVVITCLECGHIMRYPYL  108 (121)
T ss_pred             HHhhcCCCeeecCC--ceEEEEecCCcc----eEEEECccCCCEEeeccc
Confidence            37999999987774  443222221111    268899999987766443


No 91 
>COG5188 PRP9 Splicing factor 3a, subunit 3 [RNA processing and modification]
Probab=23.49  E-value=24  Score=34.77  Aligned_cols=14  Identities=21%  Similarity=0.420  Sum_probs=12.4

Q ss_pred             ecCCCCcccccccc
Q 025008            6 WCGGCNSMIAKGVR   19 (259)
Q Consensus         6 wC~~C~~~I~kGvR   19 (259)
                      .|.-||||+|.|.+
T Consensus       376 ~CEICgNyvy~GR~  389 (470)
T COG5188         376 ECEICGNYVYYGRD  389 (470)
T ss_pred             eeeecccccccchH
Confidence            49999999999964


No 92 
>PRK11639 zinc uptake transcriptional repressor; Provisional
Probab=23.38  E-value=61  Score=27.74  Aligned_cols=46  Identities=9%  Similarity=0.148  Sum_probs=26.2

Q ss_pred             cceecCCCCccccc-cccccceeecc----CceeeeeeEEEEEEcCCCCce
Q 025008            3 FNIWCGGCNSMIAK-GVRFNAEKKQV----GNYYSTKIWSFTMKSPCCKHQ   48 (259)
Q Consensus         3 F~iwC~~C~~~I~k-GvRFNAeKk~v----g~Y~st~I~~F~mkC~~C~~~   48 (259)
                      +.+.|..||..|-- +.-+..--+.+    |.-....-..|+..|+.|.+.
T Consensus        99 ~H~iC~~CGki~~i~~~~l~~~~~~~~~~~gf~i~~~~l~~~GiC~~C~~~  149 (169)
T PRK11639         99 AMFICDRCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEV  149 (169)
T ss_pred             CeEEeCCCCCEEEecccHHHHHHHHHHHHcCCEEeccEEEEEEEChhhcCc
Confidence            46899999975532 11122212223    333344556777889999665


No 93 
>TIGR02652 conserved hypothetical protein TIGR02652, cyanobacterial. Members of this family of conserved hypothetical proteins are found, so far, only in the Cyanobacteria. Members are about 170 amino acids long and share a motif CxxCx(14)CxxH near the amino end.
Probab=23.14  E-value=34  Score=29.65  Aligned_cols=35  Identities=26%  Similarity=0.606  Sum_probs=27.0

Q ss_pred             eeEEEEEEcCCCCceeE---------------EecCCCCCCeeeecCccc
Q 025008           34 KIWSFTMKSPCCKHQIV---------------IQTDPKNCEYVIISGAQR   68 (259)
Q Consensus        34 ~I~~F~mkC~~C~~~i~---------------ikTDPkn~dYvv~~GarR   68 (259)
                      |||-=.|.||.|-..|.               |.-||++.+-|-..-+|+
T Consensus         4 PIFGpei~CPhCRQ~ipALtLTDtYLC~rHGaFEAdP~t~eLVHLqSgR~   53 (163)
T TIGR02652         4 PIFGPEIRCPHCRQNIPALTLTDTYLCNRHGAFEADPETGELVHLQSGRR   53 (163)
T ss_pred             CccCCcCcCchhhcccchheecceeeccCCCccccCCCCCceEEeecCce
Confidence            67777777877777664               889999999987766654


No 94 
>KOG1296 consensus Uncharacterized conserved protein [Function unknown]
Probab=23.13  E-value=27  Score=30.40  Aligned_cols=47  Identities=26%  Similarity=0.420  Sum_probs=25.3

Q ss_pred             cceecCCCCccccccccc--cceeeccCceeeeeeEEEEEEcCCCCceeEEe
Q 025008            3 FNIWCGGCNSMIAKGVRF--NAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQ   52 (259)
Q Consensus         3 F~iwC~~C~~~I~kGvRF--NAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ik   52 (259)
                      |.+.|+.||+.--+=+=-  |-+=..-| -=||-  +|-|||..|+.+-.|-
T Consensus        29 ~kLkCtnCgE~~dkw~~I~l~E~~~~pg-~Rgta--~~v~KCK~C~Rensv~   77 (161)
T KOG1296|consen   29 LKLKCTNCGELSDKWQYITLNEEVAMPG-SRGTA--SFVMKCKFCSRENSVT   77 (161)
T ss_pred             EEeccccccccCCceEEEEeeeeecCCC-Ccchh--hHhhhhhhhcccCcEE
Confidence            457899999743322111  11100001 01222  8999999999876664


No 95 
>PF13790 DUF4182:  Domain of unknown function (DUF4182)
Probab=22.87  E-value=1e+02  Score=20.82  Aligned_cols=30  Identities=33%  Similarity=0.609  Sum_probs=18.5

Q ss_pred             ceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCC
Q 025008            4 NIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCK   46 (259)
Q Consensus         4 ~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~   46 (259)
                      .|.|.+|+..|.-   |-.+          ++=-||-.|..|.
T Consensus         3 tIvCq~C~~~Id~---~e~e----------kV~~lYg~C~~~e   32 (38)
T PF13790_consen    3 TIVCQHCNETIDH---FETE----------KVTTLYGKCGKCE   32 (38)
T ss_pred             EEEeccccceeee---ecCC----------cEEEEEEECCCCc
Confidence            4789999988752   3332          3334566777654


No 96 
>KOG4582 consensus Uncharacterized conserved protein, contains ZZ-type Zn-finger [General function prediction only]
Probab=22.58  E-value=51  Score=30.80  Aligned_cols=16  Identities=25%  Similarity=0.609  Sum_probs=10.7

Q ss_pred             eecCCCCccccccccc
Q 025008            5 IWCGGCNSMIAKGVRF   20 (259)
Q Consensus         5 iwC~~C~~~I~kGvRF   20 (259)
                      +-|.+|+.+.=-|.||
T Consensus       153 v~CD~C~~~~IvG~Ry  168 (278)
T KOG4582|consen  153 VPCDNCGKPGIVGARY  168 (278)
T ss_pred             ccCCCccCCcccccee
Confidence            8888888765445444


No 97 
>PF04810 zf-Sec23_Sec24:  Sec23/Sec24 zinc finger;  InterPro: IPR006895 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  COPII (coat protein complex II)-coated vesicles carry proteins from the endoplasmic reticulum (ER) to the Golgi complex []. COPII-coated vesicles form on the ER by the stepwise recruitment of three cytosolic components: Sar1-GTP to initiate coat formation, Sec23/24 heterodimer to select SNARE and cargo molecules, and Sec13/31 to induce coat polymerisation and membrane deformation [].  Sec23 p and Sec24p are structurally related, folding into five distinct domains: a beta-barrel, a zinc-finger, an alpha/beta trunk domain (IPR006896 from INTERPRO), an all-helical region (IPR006900 from INTERPRO), and a C-terminal gelsolin-like domain (IPR007123 from INTERPRO). This entry describes an approximately 55-residue Sec23/24 zinc-binding domain, which lies against the beta-barrel at the periphery of the complex. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0006886 intracellular protein transport, 0006888 ER to Golgi vesicle-mediated transport, 0030127 COPII vesicle coat; PDB: 3EFO_B 3EG9_B 3EGD_A 2YRC_A 2NUP_A 2YRD_A 3EGX_A 2NUT_A 3EH1_A 1PD0_A ....
Probab=22.50  E-value=39  Score=22.39  Aligned_cols=35  Identities=17%  Similarity=0.377  Sum_probs=17.5

Q ss_pred             eecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEEe
Q 025008            5 IWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQ   52 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ik   52 (259)
                      ++|..|+.||--=+.|+-..+             ..+|..|+..-.|.
T Consensus         3 ~rC~~C~aylNp~~~~~~~~~-------------~w~C~~C~~~N~lp   37 (40)
T PF04810_consen    3 VRCRRCRAYLNPFCQFDDGGK-------------TWICNFCGTKNPLP   37 (40)
T ss_dssp             -B-TTT--BS-TTSEEETTTT-------------EEEETTT--EEE--
T ss_pred             cccCCCCCEECCcceEcCCCC-------------EEECcCCCCcCCCC
Confidence            789999999877777765211             24688887755543


No 98 
>PRK00807 50S ribosomal protein L24e; Validated
Probab=22.24  E-value=27  Score=24.71  Aligned_cols=43  Identities=16%  Similarity=0.315  Sum_probs=28.7

Q ss_pred             ecCCCCcccc--ccccccceeeccCceeeeeeEEEEEEcCCCCceeEEecCCCCC
Q 025008            6 WCGGCNSMIA--KGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVIQTDPKNC   58 (259)
Q Consensus         6 wC~~C~~~I~--kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~ikTDPkn~   58 (259)
                      .|.-||.-|+  .|..|=...        -+  -|++=|..|...+-.+.+|..-
T Consensus         3 ~C~fcG~~I~pg~G~~~vr~D--------gk--v~~Fcs~KC~~~f~~~~nprk~   47 (52)
T PRK00807          3 TCSFCGKEIEPGTGKMYVKKD--------GT--ILYFCSSKCEKNYKLGRVPRKL   47 (52)
T ss_pred             ccCCCCCeEcCCCCeEEEEeC--------Cc--EEEEeCHHHHHHHHccCCCCcc
Confidence            4899998887  554432211        12  3566677888888899998754


No 99 
>PRK04023 DNA polymerase II large subunit; Validated
Probab=21.88  E-value=43  Score=37.03  Aligned_cols=8  Identities=25%  Similarity=0.701  Sum_probs=6.3

Q ss_pred             ecCCCCcc
Q 025008            6 WCGGCNSM   13 (259)
Q Consensus         6 wC~~C~~~   13 (259)
                      .|..||..
T Consensus       628 fCpsCG~~  635 (1121)
T PRK04023        628 KCPSCGKE  635 (1121)
T ss_pred             cCCCCCCc
Confidence            68888877


No 100
>PF14447 Prok-RING_4:  Prokaryotic RING finger family 4
Probab=21.83  E-value=49  Score=24.06  Aligned_cols=10  Identities=20%  Similarity=0.564  Sum_probs=8.5

Q ss_pred             cCCCCceeEE
Q 025008           42 SPCCKHQIVI   51 (259)
Q Consensus        42 C~~C~~~i~i   51 (259)
                      ||.|+..|+.
T Consensus        42 CPfC~~~~~~   51 (55)
T PF14447_consen   42 CPFCGTPFEF   51 (55)
T ss_pred             CCCCCCcccC
Confidence            9999988864


No 101
>COG2023 RPR2 RNase P subunit RPR2 [Translation, ribosomal structure and biogenesis]
Probab=21.40  E-value=1.3e+02  Score=24.70  Aligned_cols=38  Identities=16%  Similarity=0.217  Sum_probs=27.5

Q ss_pred             eecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCceeEE
Q 025008            5 IWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQIVI   51 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i~i   51 (259)
                      ..|.+|.....-|+  |++-+-.+.+       -.+.|..|+...-|
T Consensus        57 ~~CkkC~t~Lvpg~--n~rvR~~~~~-------v~vtC~~CG~~~R~   94 (105)
T COG2023          57 TICKKCYTPLVPGK--NARVRLRKGR-------VVVTCLECGTIRRY   94 (105)
T ss_pred             HhccccCcccccCc--ceEEEEcCCe-------EEEEecCCCcEEEe
Confidence            36999999877774  5655555555       56789999987665


No 102
>PF10263 SprT-like:  SprT-like family;  InterPro: IPR006640 This is a family of uncharacterised bacterial proteins which includes Escherichia coli SprT (P39902 from SWISSPROT). SprT is described as a regulator of bolA gene in stationary phase []. The majority of members contain the metallopeptidase zinc binding signature which has a HExxH motif, however there is no evidence for them being metallopeptidases. 
Probab=21.33  E-value=98  Score=25.32  Aligned_cols=27  Identities=15%  Similarity=0.332  Sum_probs=17.4

Q ss_pred             EEEEEEcCCCCceeEEecCCCCCCeee
Q 025008           36 WSFTMKSPCCKHQIVIQTDPKNCEYVI   62 (259)
Q Consensus        36 ~~F~mkC~~C~~~i~ikTDPkn~dYvv   62 (259)
                      ++|...|+.|+..+.-+..-+-..|.+
T Consensus       120 ~~~~~~C~~C~~~~~r~~~~~~~~~~C  146 (157)
T PF10263_consen  120 KKYVYRCPSCGREYKRHRRSKRKRYRC  146 (157)
T ss_pred             cceEEEcCCCCCEeeeecccchhhEEC
Confidence            567777777777776666554445554


No 103
>PF01927 Mut7-C:  Mut7-C RNAse domain;  InterPro: IPR002782 This prokaryotic family of proteins have no known function. The proteins contain four conserved cysteines that may be involved in metal binding or disulphide bridges.
Probab=21.28  E-value=77  Score=26.45  Aligned_cols=46  Identities=20%  Similarity=0.356  Sum_probs=20.8

Q ss_pred             CcceecCCCCccccccccccceeeccCceeeeeeEEEEEEcCCCCcee
Q 025008            2 PFNIWCGGCNSMIAKGVRFNAEKKQVGNYYSTKIWSFTMKSPCCKHQI   49 (259)
Q Consensus         2 PF~iwC~~C~~~I~kGvRFNAeKk~vg~Y~st~I~~F~mkC~~C~~~i   49 (259)
                      |+--+|..||..+-.-.+ +.-+..|..|- ..-|.-...|+.|+.-+
T Consensus        89 ~~~sRC~~CN~~L~~v~~-~~v~~~vp~~v-~~~~~~f~~C~~C~kiy  134 (147)
T PF01927_consen   89 PIFSRCPKCNGPLRPVSK-EEVKDRVPPYV-YETYDEFWRCPGCGKIY  134 (147)
T ss_pred             CCCCccCCCCcEeeechh-hccccccCccc-cccCCeEEECCCCCCEe
Confidence            345688888874433222 22222232211 01111145688887643


No 104
>PF04828 GFA:  Glutathione-dependent formaldehyde-activating enzyme;  InterPro: IPR006913 The GFA family consists mainly of glutathione-dependent formaldehyde-activating enzymes, but also includes centromere protein V and a fission yeast protein described as uncharacterised lyase. Glutathione-dependent formaldehyde-activating enzyme catalyse the condensation of formaldehyde and glutathione to S-hydroxymethylglutathione.  All known members of this family contain 5 strongly conserved cysteine residues.; GO: 0016846 carbon-sulfur lyase activity, 0008152 metabolic process; PDB: 3FAC_B 1XA8_A 1X6M_B.
Probab=20.99  E-value=1.1e+02  Score=22.29  Aligned_cols=40  Identities=18%  Similarity=0.291  Sum_probs=23.4

Q ss_pred             ccCcee-eeeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcc
Q 025008           26 QVGNYY-STKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQ   67 (259)
Q Consensus        26 ~vg~Y~-st~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~Gar   67 (259)
                      .+..|- +.+--. +.-|+.|+..|-.. ++...+++.|..+.
T Consensus        35 ~l~~y~~s~~~~~-r~FC~~CGs~l~~~-~~~~~~~~~V~~g~   75 (92)
T PF04828_consen   35 NLKEYQFSGKGVE-RYFCPTCGSPLFSE-DERDPDLVGVNAGT   75 (92)
T ss_dssp             GEEEC--TTSSCE-EEEETTT--EEEEE-ESSTTTEEEEEGGG
T ss_pred             cceEEEeCCCcCc-CcccCCCCCeeecc-cCCCCCEEEEEeEe
Confidence            444565 333333 37799999999988 55666666665554


No 105
>COG1013 PorB Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, beta subunit [Energy production and conversion]
Probab=20.51  E-value=36  Score=32.08  Aligned_cols=18  Identities=33%  Similarity=0.787  Sum_probs=12.8

Q ss_pred             eecCCCCccccccccccc
Q 025008            5 IWCGGCNSMIAKGVRFNA   22 (259)
Q Consensus         5 iwC~~C~~~I~kGvRFNA   22 (259)
                      .||.|||+.++.-.=.+|
T Consensus        16 ~~CpGCG~~~~l~~i~~a   33 (294)
T COG1013          16 RWCPGCGEFIILKLLTQA   33 (294)
T ss_pred             CcCCCCCchHHHHHHHHh
Confidence            699999997665444444


No 106
>TIGR03830 CxxCG_CxxCG_HTH putative zinc finger/helix-turn-helix protein, YgiT family. This model describes a family of predicted regulatory proteins with a conserved zinc finger/HTH architecture. The amino-terminal region contains a novel domain, featuring two CXXC motifs and occuring in a number of small bacterial proteins as well as in the present family. The carboxyl-terminal region consists of a helix-turn-helix domain, modeled by pfam01381. The predicted function is DNA binding and transcriptional regulation.
Probab=20.50  E-value=1.5e+02  Score=23.22  Aligned_cols=8  Identities=25%  Similarity=0.775  Sum_probs=4.8

Q ss_pred             EcCCCCce
Q 025008           41 KSPCCKHQ   48 (259)
Q Consensus        41 kC~~C~~~   48 (259)
                      .|+.|+..
T Consensus        33 ~C~~CGe~   40 (127)
T TIGR03830        33 YCPACGEE   40 (127)
T ss_pred             ECCCCCCE
Confidence            46666654


No 107
>PF07255 Benyvirus_14KDa:  Benyvirus 14KDa protein;  InterPro: IPR009884 This family consists of several Benyvirus specific 14 kDa proteins of around 125 residues in length. Members of this family contain 9 conserved cysteine residues. The function of this family is unknown.
Probab=20.48  E-value=39  Score=27.76  Aligned_cols=42  Identities=21%  Similarity=0.296  Sum_probs=34.0

Q ss_pred             eeeEEEEEEcCCCCceeEEecCCCCCCeeeecCcccCCCcCC
Q 025008           33 TKIWSFTMKSPCCKHQIVIQTDPKNCEYVIISGAQRKTEEFD   74 (259)
Q Consensus        33 t~I~~F~mkC~~C~~~i~ikTDPkn~dYvv~~GarR~~e~~~   74 (259)
                      +--.-|.|+|-.|...++++..-+|..--+-.|-.|....|.
T Consensus        59 ~~RLHF~~~CV~C~~K~~~K~~Nk~H~~~~~~G~~R~~RNFS  100 (123)
T PF07255_consen   59 VCRLHFNMSCVKCCRKLKCKKQNKNHSKHVQNGYLRKVRNFS  100 (123)
T ss_pred             eeeEEEeeehhhhcccceehhcCcchHHHhhcCeEEEeccee
Confidence            334569999999999999999999988778888877765544


No 108
>PRK00464 nrdR transcriptional regulator NrdR; Validated
Probab=20.18  E-value=60  Score=27.96  Aligned_cols=24  Identities=33%  Similarity=0.559  Sum_probs=14.4

Q ss_pred             EEcCCCCcee--EEecCCCCCCeeee
Q 025008           40 MKSPCCKHQI--VIQTDPKNCEYVII   63 (259)
Q Consensus        40 mkC~~C~~~i--~ikTDPkn~dYvv~   63 (259)
                      |+||.|+++.  ++.+++-.-.|+|.
T Consensus         1 m~cp~c~~~~~~~~~s~~~~~~~~~~   26 (154)
T PRK00464          1 MRCPFCGHPDTRVIDSRPAEDGNAIR   26 (154)
T ss_pred             CcCCCCCCCCCEeEeccccCCCCcee
Confidence            7899999765  45555333344443


Done!