Citrus Sinensis ID: 025062


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26
MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGPNEEEGSTELVFDGSSSYVWPSSVKSFFVELLEVSRG
cccccccEEEEEEcccHHHHHHHHHHccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHcHHHHHccEEccccccccccHHHHHHcccccccccccccccccHHHHHHHHccccEEEEEEccccEEEccccccccccccccccccccccccccHHHHccccccHHccccEEEEEEccccccccHHHHHHHHHHHHcccccHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHccc
cccHccccEEEEEccHHHHHHHHHHHcccccccEEEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHcccHHHHHccccccccHHHHHHHHcccEEEEEEEccccccccHHHHHccEEcccccccEEcHHHcHHHHcccccHHHHHHcccEEEEEEccccccccHHHHHHHccHHHccccccccHHccccccccccccccccEEccccccccccccHHHHHHHHccccc
MKELSEGYNivglsqgnligrgvvefceggppvknfvslggphagtasvplcgsgIFCIIANnlikaevysdyvqdhlapsgylkfpndipkylekckflpklnnelpdkrnstYKECFSSLQNLVLImfkddkvlipketawfgyypdgafspvlppqktklytedwiglktlddagrVHFISVAGGHLKISKADMKkhiipylkdqaSVRVIEsrktkgpneeegstelvfdgsssyvwpssVKSFFVELLEVSRG
MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNnelpdkrnSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIpylkdqasvrviesrktkgpneeegstelvfdgsssyvwpssvKSFFVELLEVSRG
MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGPNEEEGSTELVFDGsssyvwpssvksFFVELLEVSRG
*******YNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRV******************VFDGSSSYVWPSSVKSFFVELL*****
****SEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKD**********************************PSSVKSFFVELLEV***
MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRVIE**************ELVFDGSSSYVWPSSVKSFFVELLEVSRG
***LSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQ*******************STELVFDGSSSYVWPSSVKSFFVELLEVSR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCIIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGPNEEEGSTELVFDGSSSYVWPSSVKSFFVELLEVSRG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query258 2.2.26 [Sep-21-2011]
Q20390298 Palmitoyl-protein thioest yes no 0.763 0.661 0.417 7e-36
Q54CM0289 Palmitoyl-protein thioest no no 0.771 0.688 0.357 2e-31
P45479306 Palmitoyl-protein thioest yes no 0.779 0.656 0.368 2e-31
O88531306 Palmitoyl-protein thioest yes no 0.779 0.656 0.359 1e-30
P50897306 Palmitoyl-protein thioest yes no 0.775 0.653 0.351 1e-30
Q8HXW6306 Palmitoyl-protein thioest N/A no 0.775 0.653 0.351 1e-30
P45478306 Palmitoyl-protein thioest yes no 0.779 0.656 0.334 1e-29
Q9W3C7314 Palmitoyl-protein thioest yes no 0.782 0.643 0.334 2e-25
O59747 622 Palmitoyl-protein thioest yes no 0.767 0.318 0.279 7e-20
Q6GNY7288 Lysosomal thioesterase PP N/A no 0.689 0.618 0.318 5e-17
>sp|Q20390|PPT1_CAEEL Palmitoyl-protein thioesterase 1 OS=Caenorhabditis elegans GN=ppt-1 PE=2 SV=2 Back     alignment and function desciption
 Score =  150 bits (380), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 84/201 (41%), Positives = 115/201 (57%), Gaps = 4/201 (1%)

Query: 3   ELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLC-GSGIFCIIA 61
           EL  GYN +G SQG    R V + C   PP+KN VS+GG H G    P C G  I C   
Sbjct: 96  ELKNGYNAIGFSQGAQFLRAVAQRCPN-PPMKNLVSVGGQHQGVFGAPYCIGDNIMCNGV 154

Query: 62  NNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSS 121
             LI    Y  +VQ  +  + Y   PN + +Y ++  FL  +NNE     N TYK    S
Sbjct: 155 RRLIDLGAYLPFVQKRVVQAQYWHDPNQVEEYKKRSIFLADINNEN--NNNPTYKRNLLS 212

Query: 122 LQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRVH 181
           L+NLVL+ F  D +++PK+++WFG+Y DG    +LP  +T LY ED IGLK L ++GR+H
Sbjct: 213 LKNLVLVKFNQDHMVVPKDSSWFGFYKDGDIDTILPMNETDLYKEDRIGLKKLHESGRIH 272

Query: 182 FISVAGGHLKISKADMKKHII 202
           F+ V G HL+I ++ +   II
Sbjct: 273 FMDVDGDHLQIPRSVLVNDII 293




Removes thioester-linked fatty acyl groups such as palmitate from modified cysteine residues in proteins or peptides.
Caenorhabditis elegans (taxid: 6239)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: 2EC: 2
>sp|Q54CM0|PPT3_DICDI Palmitoyl-protein thioesterase 3 OS=Dictyostelium discoideum GN=ppt3 PE=3 SV=1 Back     alignment and function description
>sp|P45479|PPT1_RAT Palmitoyl-protein thioesterase 1 OS=Rattus norvegicus GN=Ppt1 PE=1 SV=1 Back     alignment and function description
>sp|O88531|PPT1_MOUSE Palmitoyl-protein thioesterase 1 OS=Mus musculus GN=Ppt1 PE=2 SV=2 Back     alignment and function description
>sp|P50897|PPT1_HUMAN Palmitoyl-protein thioesterase 1 OS=Homo sapiens GN=PPT1 PE=1 SV=1 Back     alignment and function description
>sp|Q8HXW6|PPT1_MACFA Palmitoyl-protein thioesterase 1 OS=Macaca fascicularis GN=PPT1 PE=2 SV=1 Back     alignment and function description
>sp|P45478|PPT1_BOVIN Palmitoyl-protein thioesterase 1 OS=Bos taurus GN=PPT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9W3C7|PPT1_DROME Palmitoyl-protein thioesterase 1 OS=Drosophila melanogaster GN=Ppt1 PE=1 SV=2 Back     alignment and function description
>sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 Back     alignment and function description
>sp|Q6GNY7|PPT2B_XENLA Lysosomal thioesterase PPT2-B OS=Xenopus laevis GN=ppt2-b PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
118483969 366 unknown [Populus trichocarpa] 0.996 0.702 0.692 1e-108
224138676341 predicted protein [Populus trichocarpa] 0.961 0.727 0.723 1e-108
255581315327 Palmitoyl-protein thioesterase 1 precurs 0.980 0.773 0.696 1e-105
296084707309 unnamed protein product [Vitis vinifera] 0.930 0.776 0.720 1e-104
356497117 367 PREDICTED: palmitoyl-protein thioesteras 0.996 0.700 0.676 1e-103
359474403301 PREDICTED: palmitoyl-protein thioesteras 0.926 0.794 0.719 1e-103
428229698357 palmitoyl-protein thioesterase [Phaseolu 0.984 0.711 0.701 1e-103
224074193352 predicted protein [Populus trichocarpa] 0.980 0.718 0.713 1e-103
118482307 394 unknown [Populus trichocarpa] 0.976 0.639 0.707 1e-102
357482125327 Palmitoyl-protein thioesterase [Medicago 0.813 0.642 0.804 9e-99
>gi|118483969|gb|ABK93872.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  397 bits (1021), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/273 (69%), Positives = 228/273 (83%), Gaps = 16/273 (5%)

Query: 1   MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCII 60
           MKELS+GY+IVGLSQGNLIGRGVVEFC+GGPPVKNF+SLGGPHAGTASVPLCGSGIFC +
Sbjct: 89  MKELSKGYSIVGLSQGNLIGRGVVEFCDGGPPVKNFISLGGPHAGTASVPLCGSGIFCKL 148

Query: 61  ANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS 120
           A+ LIK+++YSDYVQ HLAPSGYLKFPNDIP Y+EKC+FLPKLNNE+P++RN+TYKE FS
Sbjct: 149 ADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFLPKLNNEIPEERNTTYKERFS 208

Query: 121 SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV 180
           SLQNLVLIMF++D VLIPKET+WFGYYPDGAF P++P  +T LYTEDWIGLK LD+AGRV
Sbjct: 209 SLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPAHQTALYTEDWIGLKALDEAGRV 268

Query: 181 HFISVAGGHLKISKADMKKHIIPYLKDQASV------------RVI----ESRKTKGPNE 224
           HF++V+GGHL IS++DMKKH++P+L D+ASV            R I      ++  G   
Sbjct: 269 HFVNVSGGHLGISESDMKKHVVPFLVDEASVEKYSNARAHGLPRTITQNYHRKQVAGSFI 328

Query: 225 EEGSTELVFDGSSSYVWPSSVKSFFVELLEVSR 257
           +E S E + DGSSSY WPSSVK+FF EL+ ++ 
Sbjct: 329 DETSNERILDGSSSYQWPSSVKNFFRELVGLAE 361




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224138676|ref|XP_002326662.1| predicted protein [Populus trichocarpa] gi|222833984|gb|EEE72461.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255581315|ref|XP_002531468.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus communis] gi|223528922|gb|EEF30918.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|296084707|emb|CBI25849.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356497117|ref|XP_003517409.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max] Back     alignment and taxonomy information
>gi|359474403|ref|XP_002269785.2| PREDICTED: palmitoyl-protein thioesterase 1-like, partial [Vitis vinifera] Back     alignment and taxonomy information
>gi|428229698|gb|AFY98638.1| palmitoyl-protein thioesterase [Phaseolus vulgaris] Back     alignment and taxonomy information
>gi|224074193|ref|XP_002304295.1| predicted protein [Populus trichocarpa] gi|222841727|gb|EEE79274.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118482307|gb|ABK93080.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|357482125|ref|XP_003611348.1| Palmitoyl-protein thioesterase [Medicago truncatula] gi|355512683|gb|AES94306.1| Palmitoyl-protein thioesterase [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query258
TAIR|locus:2171554314 AT5G47330 [Arabidopsis thalian 0.860 0.707 0.653 1.5e-83
TAIR|locus:2081942338 AT3G60340 [Arabidopsis thalian 0.810 0.618 0.7 3.1e-83
TAIR|locus:2171564317 AT5G47340 [Arabidopsis thalian 0.860 0.700 0.592 4e-74
TAIR|locus:2129066308 AT4G17470 [Arabidopsis thalian 0.802 0.672 0.641 1.7e-73
TAIR|locus:2129076304 AT4G17480 [Arabidopsis thalian 0.786 0.667 0.615 1.1e-71
TAIR|locus:2171599316 AT5G47350 [Arabidopsis thalian 0.860 0.702 0.573 4.3e-70
TAIR|locus:2129086300 AT4G17483 [Arabidopsis thalian 0.794 0.683 0.619 7e-70
DICTYBASE|DDB_G0285533303 ppt1 "palmitoyl-protein thioes 0.786 0.669 0.429 1.6e-40
WB|WBGene00004092298 ppt-1 [Caenorhabditis elegans 0.763 0.661 0.417 3.7e-39
CGD|CAL0000194316 orf19.540 [Candida albicans (t 0.751 0.613 0.393 6.7e-33
TAIR|locus:2171554 AT5G47330 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 837 (299.7 bits), Expect = 1.5e-83, P = 1.5e-83
 Identities = 145/222 (65%), Positives = 186/222 (83%)

Query:     1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCII 60
             MKELS+GYNIVG SQGNL+ RG++EFC+GGPPV N++SL GPHAG +SVP+CGSG+FC +
Sbjct:    90 MKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSVPMCGSGLFCKL 149

Query:    61 ANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS 120
             A+ LIK ++YSD++QDHLAPSGYLK P D+ KYL   K+LPKLNNE+PD+RN TYK+ F+
Sbjct:   150 ADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKLNNEIPDQRNQTYKDRFT 209

Query:   121 SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV 180
             SL NLVLI F+ DKV++PK+++WFG+YPDG F P+L  Q+TKLYTEDWIGLKTLDDAG+V
Sbjct:   210 SLHNLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGLKTLDDAGKV 269

Query:   181 HFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGP 222
              F+SVAG H+++   D+ KH++PYL+DQ S     +RKTK P
Sbjct:   270 KFVSVAGEHIRMVDEDVVKHVVPYLQDQPSSVQSFNRKTKQP 311




GO:0006464 "cellular protein modification process" evidence=IEA
GO:0008474 "palmitoyl-(protein) hydrolase activity" evidence=IEA;ISS
GO:0006865 "amino acid transport" evidence=RCA
GO:0015824 "proline transport" evidence=RCA
TAIR|locus:2081942 AT3G60340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171564 AT5G47340 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129066 AT4G17470 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129076 AT4G17480 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2171599 AT5G47350 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2129086 AT4G17483 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0285533 ppt1 "palmitoyl-protein thioesterase 1" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
WB|WBGene00004092 ppt-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
CGD|CAL0000194 orf19.540 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!
3rd Layer3.1.2.22LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
PLN02633314 PLN02633, PLN02633, palmitoyl protein thioesterase 1e-123
PLN02606306 PLN02606, PLN02606, palmitoyl-protein thioesterase 1e-105
pfam02089279 pfam02089, Palm_thioest, Palmitoyl protein thioest 5e-37
COG1075336 COG1075, LipA, Predicted acetyltransferases and hy 0.004
>gnl|CDD|178240 PLN02633, PLN02633, palmitoyl protein thioesterase family protein Back     alignment and domain information
 Score =  353 bits (906), Expect = e-123
 Identities = 142/223 (63%), Positives = 184/223 (82%), Gaps = 1/223 (0%)

Query: 1   MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG-SGIFCI 59
           MKELS+GYNIVG SQGNL+ RG++EFC+GGPPV N++SL GPHAG +S+P CG SG+ C 
Sbjct: 89  MKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSLPRCGTSGLICK 148

Query: 60  IANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECF 119
           IAN LIK +VYSD++QDHLAPSGY K P D+ +YL+  K+LPKLNNE+PD+RN TYK+ F
Sbjct: 149 IANELIKGDVYSDFIQDHLAPSGYYKIPKDVTEYLKGSKYLPKLNNEIPDQRNQTYKDRF 208

Query: 120 SSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGR 179
           +SLQNLVL+ F++D V++PK+++WFG+YPDG F  +L  Q+TKLYTEDWIGLKTLDDAG+
Sbjct: 209 TSLQNLVLVKFQNDTVIVPKDSSWFGFYPDGEFEHLLSVQQTKLYTEDWIGLKTLDDAGK 268

Query: 180 VHFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGP 222
           V F+SV GGHL ++  D+ K+++PYL+DQ S     +RKTK P
Sbjct: 269 VKFVSVPGGHLIMADEDVVKYVVPYLQDQQSAAQRLNRKTKEP 311


Length = 314

>gnl|CDD|215326 PLN02606, PLN02606, palmitoyl-protein thioesterase Back     alignment and domain information
>gnl|CDD|202109 pfam02089, Palm_thioest, Palmitoyl protein thioesterase Back     alignment and domain information
>gnl|CDD|224001 COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 258
PLN02633314 palmitoyl protein thioesterase family protein 100.0
PLN02606306 palmitoyl-protein thioesterase 100.0
KOG2541296 consensus Palmitoyl protein thioesterase [Lipid tr 100.0
PF02089279 Palm_thioest: Palmitoyl protein thioesterase; Inte 100.0
PF01674219 Lipase_2: Lipase (class 2); InterPro: IPR002918 Li 99.45
PF05057217 DUF676: Putative serine esterase (DUF676); InterPr 98.81
PF07819225 PGAP1: PGAP1-like protein; InterPro: IPR012908 The 98.52
COG1075336 LipA Predicted acetyltransferases and hydrolases w 98.5
PF06028255 DUF915: Alpha/beta hydrolase of unknown function ( 98.44
PF02450389 LCAT: Lecithin:cholesterol acyltransferase; InterP 98.1
PLN02733440 phosphatidylcholine-sterol O-acyltransferase 98.01
KOG3724 973 consensus Negative regulator of COPII vesicle form 97.32
COG4814288 Uncharacterized protein with an alpha/beta hydrola 97.24
PF00561230 Abhydrolase_1: alpha/beta hydrolase fold A web pag 97.19
PF12697228 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 96.65
PLN02965255 Probable pheophorbidase 96.57
cd00741153 Lipase Lipase. Lipases are esterases that can hydr 96.54
PLN02211273 methyl indole-3-acetate methyltransferase 96.34
PLN02824294 hydrolase, alpha/beta fold family protein 96.21
TIGR01836350 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth 96.17
PRK10985324 putative hydrolase; Provisional 96.13
TIGR03343282 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die 96.12
PRK10349256 carboxylesterase BioH; Provisional 96.1
PLN02517 642 phosphatidylcholine-sterol O-acyltransferase 95.95
PRK10749330 lysophospholipase L2; Provisional 95.82
PRK11126242 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl 95.82
TIGR03056278 bchO_mg_che_rel putative magnesium chelatase acces 95.81
PRK10673255 acyl-CoA esterase; Provisional 95.76
TIGR01250288 pro_imino_pep_2 proline-specific peptidases, Bacil 95.75
PLN02578354 hydrolase 95.73
PLN03087481 BODYGUARD 1 domain containing hydrolase; Provision 95.71
KOG4372405 consensus Predicted alpha/beta hydrolase [General 95.67
TIGR01607332 PST-A Plasmodium subtelomeric family (PST-A). Thes 95.65
PRK08775343 homoserine O-acetyltransferase; Provisional 95.61
TIGR02240276 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer 95.54
TIGR03695251 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene 95.52
PF12695145 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 95.51
PRK03592295 haloalkane dehalogenase; Provisional 95.5
TIGR01738245 bioH putative pimeloyl-BioC--CoA transferase BioH. 95.48
TIGR02427251 protocat_pcaD 3-oxoadipate enol-lactonase. Members 95.45
PRK00870302 haloalkane dehalogenase; Provisional 95.45
TIGR01392351 homoserO_Ac_trn homoserine O-acetyltransferase. Th 95.3
PHA02857276 monoglyceride lipase; Provisional 95.25
PRK03204286 haloalkane dehalogenase; Provisional 95.21
PLN02298330 hydrolase, alpha/beta fold family protein 95.17
COG2267298 PldB Lysophospholipase [Lipid metabolism] 95.13
KOG2369473 consensus Lecithin:cholesterol acyltransferase (LC 95.12
cd00707275 Pancreat_lipase_like Pancreatic lipase-like enzyme 95.08
TIGR03611257 RutD pyrimidine utilization protein D. This protei 95.06
COG0596282 MhpC Predicted hydrolases or acyltransferases (alp 94.77
PRK06489360 hypothetical protein; Provisional 94.65
PF02230216 Abhydrolase_2: Phospholipase/Carboxylesterase; Int 94.6
PLN02511388 hydrolase 94.36
PLN02894402 hydrolase, alpha/beta fold family protein 94.31
PLN02385349 hydrolase; alpha/beta fold family protein 94.02
PRK07581339 hypothetical protein; Validated 94.02
TIGR03230442 lipo_lipase lipoprotein lipase. Members of this pr 93.78
PRK14875371 acetoin dehydrogenase E2 subunit dihydrolipoyllysi 93.71
TIGR01840212 esterase_phb esterase, PHB depolymerase family. Th 93.5
PF01764140 Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr 93.39
KOG4409365 consensus Predicted hydrolase/acyltransferase (alp 93.21
PF11288207 DUF3089: Protein of unknown function (DUF3089); In 93.21
PRK00175379 metX homoserine O-acetyltransferase; Provisional 93.19
PRK07868 994 acyl-CoA synthetase; Validated 93.1
TIGR01249306 pro_imino_pep_1 proline iminopeptidase, Neisseria- 93.0
PRK06765389 homoserine O-acetyltransferase; Provisional 92.77
PLN02679360 hydrolase, alpha/beta fold family protein 92.67
TIGR03101266 hydr2_PEP hydrolase, ortholog 2, exosortase system 92.63
PF01083179 Cutinase: Cutinase; InterPro: IPR000675 Aerial pla 92.56
PRK11460232 putative hydrolase; Provisional 92.15
KOG2029697 consensus Uncharacterized conserved protein [Funct 91.91
cd00519229 Lipase_3 Lipase (class 3). Lipases are esterases t 91.78
PF00975229 Thioesterase: Thioesterase domain; InterPro: IPR00 91.64
PF06259177 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR 91.46
PF03959212 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 91.03
TIGR01839560 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase 90.94
PF08237225 PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum 90.79
TIGR02821275 fghA_ester_D S-formylglutathione hydrolase. This m 90.68
TIGR01838532 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, 90.65
KOG1454326 consensus Predicted hydrolase/acyltransferase (alp 90.6
PLN02652395 hydrolase; alpha/beta fold family protein 90.53
PRK11071190 esterase YqiA; Provisional 90.45
PRK05077414 frsA fermentation/respiration switch protein; Revi 90.19
PLN029801655 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi 90.18
PF05990233 DUF900: Alpha/beta hydrolase of unknown function ( 90.17
COG0400207 Predicted esterase [General function prediction on 90.04
PLN03084383 alpha/beta hydrolase fold protein; Provisional 89.97
PLN02442283 S-formylglutathione hydrolase 89.74
PRK10566249 esterase; Provisional 89.58
PLN02872395 triacylglycerol lipase 89.57
TIGR03100274 hydr1_PEP hydrolase, ortholog 1, exosortase system 89.55
TIGR01849406 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, 89.13
PF00151331 Lipase: Lipase; InterPro: IPR013818 Triglyceride l 88.47
PF11187224 DUF2974: Protein of unknown function (DUF2974); In 88.33
KOG2564343 consensus Predicted acetyltransferases and hydrola 87.54
PLN00021313 chlorophyllase 87.26
COG3243445 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me 86.88
COG1647243 Esterase/lipase [General function prediction only] 86.21
KOG2624403 consensus Triglyceride lipase-cholesterol esterase 85.89
KOG2205424 consensus Uncharacterized conserved protein [Funct 85.78
PRK05855 582 short chain dehydrogenase; Validated 85.55
PF00326213 Peptidase_S9: Prolyl oligopeptidase family This fa 84.04
PF06821171 Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 83.37
PLN02408365 phospholipase A1 82.4
TIGR03502792 lipase_Pla1_cef extracellular lipase, Pla-1/cef fa 81.47
KOG4178322 consensus Soluble epoxide hydrolase [Lipid transpo 81.39
PLN00413479 triacylglycerol lipase 81.2
PF05277345 DUF726: Protein of unknown function (DUF726); Inte 81.14
PLN02310405 triacylglycerol lipase 81.05
PRK13604307 luxD acyl transferase; Provisional 80.22
>PLN02633 palmitoyl protein thioesterase family protein Back     alignment and domain information
Probab=100.00  E-value=3.9e-82  Score=585.33  Aligned_cols=214  Identities=64%  Similarity=1.195  Sum_probs=207.2

Q ss_pred             CccCCCcccEEEeChhhHHHHHHHHhcCCCCCcceEEEecCCCCCcccccCCC-ChhHHHHHHHhHhhhcccHHhhhccc
Q 025062            1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG-SGIFCIIANNLIKAEVYSDYVQDHLA   79 (258)
Q Consensus         1 ~~~l~~GvnlIGhSQGGli~Rayiq~~~g~~kV~nlISLggPh~G~~~~P~c~-~~~lc~~~~~ll~~~~Y~~~vQ~~l~   79 (258)
                      ||+|++|||+|||||||+|+|||||+|+++|+|+|||||||||+|++++|.|+ ++++|++++++++.++|++++|++++
T Consensus        89 ~~~l~~G~naIGfSQGGlflRa~ierc~~~p~V~nlISlggph~Gv~g~p~C~~~~~~C~~~~~ll~~~~Ys~~vQ~~lv  168 (314)
T PLN02633         89 MKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSLPRCGTSGLICKIANELIKGDVYSDFIQDHLA  168 (314)
T ss_pred             chhhhCcEEEEEEccchHHHHHHHHHCCCCCCcceEEEecCCCCCeeCCCCCCcchhhHHHHHHHHhhCCccHHHHhccc
Confidence            68999999999999999999999999997689999999999999999999996 78999999999999999999999999


Q ss_pred             cCCccCCCCChhhhhhcCcchHHHHcCCCCCCchhHHHhhhccCCeEEEEeCCCcEeecCCcCcccccCCCCCcccccCc
Q 025062           80 PSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQ  159 (258)
Q Consensus        80 ~A~Y~rdP~~~~~yl~~S~FL~~LNne~~~~~n~~Yk~nf~~L~~~vli~~~~D~vV~P~eSs~Fg~y~~~~~~~vvpm~  159 (258)
                      ||||||||.+++.|+++|.|||+||||++...|.+||+||++|++||||+|++|+||+||||||||||++++.++|+||+
T Consensus       169 ~A~Yw~DP~~~d~Yl~~s~FLadINNEr~~~~n~tyK~Nf~~L~~~Vlv~f~~DtvV~PkeSswFg~Y~~~~~~~vvpl~  248 (314)
T PLN02633        169 PSGYYKIPKDVTEYLKGSKYLPKLNNEIPDQRNQTYKDRFTSLQNLVLVKFQNDTVIVPKDSSWFGFYPDGEFEHLLSVQ  248 (314)
T ss_pred             cccccCCchhHHHHHhcCcchhhhhCcCcccccHHHHHHHHhhhceEEEecCCCceECCCccccceeccCCCCceeechh
Confidence            99999999999999999999999999997778999999999999999999999999999999999999998878999999


Q ss_pred             ccccccccccchHhHhhcCCeEEEeecCCcceecHHHHHHhhHhhhccccchhhh
Q 025062          160 KTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRVI  214 (258)
Q Consensus       160 et~~Y~eD~iGLktLde~G~l~f~~v~G~H~~~~~~~~~~~i~pyl~~~~~~~~~  214 (258)
                      ||++|+||||||||||++|||+|+++||+||+++++++.++|+|||.++.+++++
T Consensus       249 et~lY~eD~iGLktLD~~GkL~f~~v~G~Hl~~s~~~~~~~i~pyL~~~~~~~~~  303 (314)
T PLN02633        249 QTKLYTEDWIGLKTLDDAGKVKFVSVPGGHLIMADEDVVKYVVPYLQDQQSAAQR  303 (314)
T ss_pred             hcchhhhhhhhHHHHHHCCCeEEEecCCchhhcCHHHHHHHHHHHhhccchhHHH
Confidence            9999999999999999999999999999999999999999999999999887554



>PLN02606 palmitoyl-protein thioesterase Back     alignment and domain information
>KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children Back     alignment and domain information
>PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] Back     alignment and domain information
>PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases Back     alignment and domain information
>PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) Back     alignment and domain information
>COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 Back     alignment and domain information
>PLN02733 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases Back     alignment and domain information
>PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A Back     alignment and domain information
>PLN02965 Probable pheophorbidase Back     alignment and domain information
>cd00741 Lipase Lipase Back     alignment and domain information
>PLN02211 methyl indole-3-acetate methyltransferase Back     alignment and domain information
>PLN02824 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit Back     alignment and domain information
>PRK10985 putative hydrolase; Provisional Back     alignment and domain information
>TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase Back     alignment and domain information
>PRK10349 carboxylesterase BioH; Provisional Back     alignment and domain information
>PLN02517 phosphatidylcholine-sterol O-acyltransferase Back     alignment and domain information
>PRK10749 lysophospholipase L2; Provisional Back     alignment and domain information
>PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional Back     alignment and domain information
>TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein Back     alignment and domain information
>PRK10673 acyl-CoA esterase; Provisional Back     alignment and domain information
>TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily Back     alignment and domain information
>PLN02578 hydrolase Back     alignment and domain information
>PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional Back     alignment and domain information
>KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) Back     alignment and domain information
>PRK08775 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase Back     alignment and domain information
>TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase Back     alignment and domain information
>PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A Back     alignment and domain information
>PRK03592 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH Back     alignment and domain information
>TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase Back     alignment and domain information
>PRK00870 haloalkane dehalogenase; Provisional Back     alignment and domain information
>TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase Back     alignment and domain information
>PHA02857 monoglyceride lipase; Provisional Back     alignment and domain information
>PRK03204 haloalkane dehalogenase; Provisional Back     alignment and domain information
>PLN02298 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>COG2267 PldB Lysophospholipase [Lipid metabolism] Back     alignment and domain information
>KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] Back     alignment and domain information
>cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes Back     alignment and domain information
>TIGR03611 RutD pyrimidine utilization protein D Back     alignment and domain information
>COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PRK06489 hypothetical protein; Provisional Back     alignment and domain information
>PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases Back     alignment and domain information
>PLN02511 hydrolase Back     alignment and domain information
>PLN02894 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>PLN02385 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK07581 hypothetical protein; Validated Back     alignment and domain information
>TIGR03230 lipo_lipase lipoprotein lipase Back     alignment and domain information
>PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional Back     alignment and domain information
>TIGR01840 esterase_phb esterase, PHB depolymerase family Back     alignment and domain information
>PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] Back     alignment and domain information
>KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function Back     alignment and domain information
>PRK00175 metX homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily Back     alignment and domain information
>PRK06765 homoserine O-acetyltransferase; Provisional Back     alignment and domain information
>PLN02679 hydrolase, alpha/beta fold family protein Back     alignment and domain information
>TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated Back     alignment and domain information
>PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] Back     alignment and domain information
>PRK11460 putative hydrolase; Provisional Back     alignment and domain information
>KOG2029 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd00519 Lipase_3 Lipase (class 3) Back     alignment and domain information
>PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] Back     alignment and domain information
>PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria Back     alignment and domain information
>PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family Back     alignment and domain information
>TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II Back     alignment and domain information
>PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) Back     alignment and domain information
>TIGR02821 fghA_ester_D S-formylglutathione hydrolase Back     alignment and domain information
>TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I Back     alignment and domain information
>KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] Back     alignment and domain information
>PLN02652 hydrolase; alpha/beta fold family protein Back     alignment and domain information
>PRK11071 esterase YqiA; Provisional Back     alignment and domain information
>PRK05077 frsA fermentation/respiration switch protein; Reviewed Back     alignment and domain information
>PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding Back     alignment and domain information
>PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like Back     alignment and domain information
>COG0400 Predicted esterase [General function prediction only] Back     alignment and domain information
>PLN03084 alpha/beta hydrolase fold protein; Provisional Back     alignment and domain information
>PLN02442 S-formylglutathione hydrolase Back     alignment and domain information
>PRK10566 esterase; Provisional Back     alignment and domain information
>PLN02872 triacylglycerol lipase Back     alignment and domain information
>TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated Back     alignment and domain information
>TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular Back     alignment and domain information
>PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 Back     alignment and domain information
>PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function Back     alignment and domain information
>KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] Back     alignment and domain information
>PLN00021 chlorophyllase Back     alignment and domain information
>COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] Back     alignment and domain information
>COG1647 Esterase/lipase [General function prediction only] Back     alignment and domain information
>KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] Back     alignment and domain information
>KOG2205 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification Back     alignment and domain information
>PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic Back     alignment and domain information
>PLN02408 phospholipase A1 Back     alignment and domain information
>TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family Back     alignment and domain information
>KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] Back     alignment and domain information
>PLN00413 triacylglycerol lipase Back     alignment and domain information
>PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins Back     alignment and domain information
>PLN02310 triacylglycerol lipase Back     alignment and domain information
>PRK13604 luxD acyl transferase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1eh5_A279 Crystal Structure Of Palmitoyl Protein Thioesterase 9e-31
3gro_A298 Human Palmitoyl-Protein Thioesterase 1 Length = 298 1e-30
1pja_A302 The Crystal Structure Of Palmitoyl Protein Thioeste 6e-10
>pdb|1EH5|A Chain A, Crystal Structure Of Palmitoyl Protein Thioesterase 1 Complexed With Palmitate Length = 279 Back     alignment and structure

Iteration: 1

Score = 130 bits (326), Expect = 9e-31, Method: Compositional matrix adjust. Identities = 69/206 (33%), Positives = 111/206 (53%), Gaps = 5/206 (2%) Query: 3 ELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLC--GSGIFCII 60 +L +GYN +G SQG R V + C PP+ N +S+GG H G +P C S C Sbjct: 77 KLQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHICDF 135 Query: 61 ANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS 120 + A Y+ +Q+ L + Y P Y FL +N E N +YK+ Sbjct: 136 IRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQE--RGVNESYKKNLM 193 Query: 121 SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV 180 +L+ V++ F +D ++ P ++ WFG+Y G +P Q++ LYT+D +GLK +D AG++ Sbjct: 194 ALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKAGQL 253 Query: 181 HFISVAGGHLKISKADMKKHIIPYLK 206 F+++ G HL++S+ HIIP+L+ Sbjct: 254 VFLALEGDHLQLSEEWFYAHIIPFLE 279
>pdb|3GRO|A Chain A, Human Palmitoyl-Protein Thioesterase 1 Length = 298 Back     alignment and structure
>pdb|1PJA|A Chain A, The Crystal Structure Of Palmitoyl Protein Thioesterase-2 Reveals The Basis For Divergent Substrate Specificities Of The Two Lysosomal Thioesterases (Ppt1 And Ppt2) Length = 302 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query258
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 1e-84
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 7e-63
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 9e-09
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 4e-08
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 1e-04
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Length = 279 Back     alignment and structure
 Score =  253 bits (647), Expect = 1e-84
 Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 5/208 (2%)

Query: 1   MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG--SGIFC 58
             +L +GYN +G SQG    R V + C   PP+ N +S+GG H G   +P C   S   C
Sbjct: 75  DPKLQQGYNAMGFSQGGQFLRAVAQRC-PSPPMVNLISVGGQHQGVFGLPRCPGESSHIC 133

Query: 59  IIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKEC 118
                 + A  Y+  +Q+ L  + Y   P     Y     FL  +N E     N +YK+ 
Sbjct: 134 DFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQERG--VNESYKKN 191

Query: 119 FSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAG 178
             +L+  V++ F +D ++ P ++ WFG+Y  G     +P Q++ LYT+D +GLK +D AG
Sbjct: 192 LMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKAG 251

Query: 179 RVHFISVAGGHLKISKADMKKHIIPYLK 206
           ++ F+++ G HL++S+     HIIP+L+
Sbjct: 252 QLVFLALEGDHLQLSEEWFYAHIIPFLE 279


>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Length = 302 Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Length = 342 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
1ei9_A279 Palmitoyl protein thioesterase 1; alpha/beta hydro 100.0
1pja_A302 Palmitoyl-protein thioesterase 2 precursor; hydrol 99.85
3icv_A316 Lipase B, CALB; circular permutation, cleavage on 99.47
2x5x_A342 PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE 99.35
1tca_A317 Lipase; hydrolase(carboxylic esterase); HET: NAG; 98.82
3fle_A249 SE_1780 protein; structural genomics, APC61035.1, 98.35
3ds8_A254 LIN2722 protein; unkonwn function, structural geno 98.34
3lp5_A250 Putative cell surface hydrolase; structural genom 98.29
2dsn_A387 Thermostable lipase; T1 lipase, hydrolase; 1.50A { 98.27
2hih_A431 Lipase 46 kDa form; A1 phospholipase, phospholipid 97.98
1ex9_A285 Lactonizing lipase; alpha-beta hydrolase fold, pho 97.77
1ys1_X320 Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h 97.66
1isp_A181 Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 97.37
3r0v_A262 Alpha/beta hydrolase fold protein; structural geno 97.21
1uxo_A192 YDEN protein; hydrolase, A/B hydrolase, esterase, 97.05
2zyr_A 484 Lipase, putative; fatty acid, hydrolase; HET: 1PE; 96.95
1xkl_A273 SABP2, salicylic acid-binding protein 2; alpha-bet 96.93
2xmz_A269 Hydrolase, alpha/beta hydrolase fold family; menaq 96.93
1m33_A258 BIOH protein; alpha-betta-alpha sandwich, structur 96.92
3c6x_A257 Hydroxynitrilase; atomic resolution, hydroxynitril 96.91
2wfl_A264 Polyneuridine-aldehyde esterase; alkaloid metaboli 96.89
3bdv_A191 Uncharacterized protein DUF1234; DUF1234 family pr 96.87
1ehy_A294 Protein (soluble epoxide hydrolase); alpha/beta hy 96.75
2cjp_A328 Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu 96.75
2ocg_A254 Valacyclovir hydrolase; alpha beta hydrolase fold; 96.74
2xua_A266 PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate 96.69
1tqh_A247 Carboxylesterase precursor; tetrahedral intermedia 96.68
1q0r_A298 RDMC, aclacinomycin methylesterase; anthracycline, 96.66
1hkh_A279 Gamma lactamase; hydrolase, alpha/beta hydrolase, 96.66
1azw_A313 Proline iminopeptidase; aminopeptidase, serine pro 96.66
2wue_A291 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas 96.66
2puj_A286 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; 96.65
1wm1_A317 Proline iminopeptidase; complex with inhibitor, hy 96.63
1mtz_A293 Proline iminopeptidase; alpha-beta hydrolase, CAP 96.62
1iup_A282 META-cleavage product hydrolase; aromatic compound 96.61
3v48_A268 Aminohydrolase, putative aminoacrylate hydrolase R 96.6
3ibt_A264 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, 96.58
3om8_A266 Probable hydrolase; structural genomics, PSI-2, pr 96.58
2qs9_A194 Retinoblastoma-binding protein 9; B5T overexpresse 96.56
3sty_A267 Methylketone synthase 1; alpha/beta hydrolase, dec 96.53
3kda_A301 CFTR inhibitory factor (CIF); alpha/beta hydrolase 96.53
3u1t_A309 DMMA haloalkane dehalogenase; alpha/beta-hydrolase 96.52
4dnp_A269 DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu 96.51
2wtm_A251 EST1E; hydrolase; 1.60A {Clostridium proteoclastic 96.51
1u2e_A289 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase 96.5
3r40_A306 Fluoroacetate dehalogenase; FACD, defluorinase, al 96.49
3dqz_A258 Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl 96.49
1zoi_A276 Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo 96.48
1c4x_A285 BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di 96.48
3bf7_A255 Esterase YBFF; thioesterase, helical CAP, hydrolas 96.46
3l80_A292 Putative uncharacterized protein SMU.1393C; alpha/ 96.45
1wom_A271 RSBQ, sigma factor SIGB regulation protein RSBQ; a 96.42
3i1i_A377 Homoserine O-acetyltransferase; structural genomic 96.41
3qit_A286 CURM TE, polyketide synthase; thioesterase, alpha/ 96.4
2psd_A318 Renilla-luciferin 2-monooxygenase; alpha/beta-hydr 96.38
3nwo_A330 PIP, proline iminopeptidase; structural genomics, 96.37
1a8q_A274 Bromoperoxidase A1; haloperoxidase, oxidoreductase 96.36
3qvm_A282 OLEI00960; structural genomics, PSI-biology, midwe 96.32
3bwx_A285 Alpha/beta hydrolase; YP_496220.1, joint center fo 96.32
3oos_A278 Alpha/beta hydrolase family protein; APC67239.0, p 96.32
2yys_A286 Proline iminopeptidase-related protein; TTHA1809, 96.31
1j1i_A296 META cleavage compound hydrolase; carbazole degrad 96.31
3pe6_A303 Monoglyceride lipase; alpha-beta hydrolase fold, 2 96.29
1a88_A275 Chloroperoxidase L; haloperoxidase, oxidoreductase 96.26
1auo_A218 Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl 96.25
4fbl_A281 LIPS lipolytic enzyme; thermostable, structural ge 96.25
1brt_A277 Bromoperoxidase A2; haloperoxidase, oxidoreductase 96.22
1r3d_A264 Conserved hypothetical protein VC1974; structural 96.22
3fsg_A272 Alpha/beta superfamily hydrolase; PF00561, MCSG, P 96.21
3e0x_A245 Lipase-esterase related protein; APC60309, clostri 96.19
2pl5_A366 Homoserine O-acetyltransferase; alpha/beta hydrola 96.18
3hju_A342 Monoglyceride lipase; alpha/beta hydrolase, hydrol 96.16
3p2m_A330 Possible hydrolase; alpha/beta hydrolase superfami 96.14
3afi_E316 Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 96.13
3ksr_A290 Putative serine hydrolase; catalytic triad, struct 96.13
3h04_A275 Uncharacterized protein; protein with unknown func 96.12
1a8s_A273 Chloroperoxidase F; haloperoxidase, oxidoreductase 96.1
3g9x_A299 Haloalkane dehalogenase; alpha/beta hydrolase, hel 96.1
3c5v_A316 PME-1, protein phosphatase methylesterase 1; demet 96.1
3qyj_A291 ALR0039 protein; alpha/beta fold, hydrolase; 1.78A 96.09
2xt0_A297 Haloalkane dehalogenase; hydrolase, alpha-beta hyd 96.09
3hss_A293 Putative bromoperoxidase; alpha beta hydrolase, ox 96.08
2qmq_A286 Protein NDRG2, protein NDR2; alpha/beta-hydrolases 96.06
2h1i_A226 Carboxylesterase; structural genomics, PSI-2, prot 96.05
2qvb_A297 Haloalkane dehalogenase 3; RV2579, alpha-beta hydr 96.04
3llc_A270 Putative hydrolase; structural genomics, joint cen 96.01
2wj6_A276 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid 95.99
2qjw_A176 Uncharacterized protein XCC1541; putative hydrolas 95.98
1fj2_A232 Protein (acyl protein thioesterase 1); alpha/beta 95.93
4g9e_A279 AHL-lactonase, alpha/beta hydrolase fold protein; 95.92
3b5e_A223 MLL8374 protein; NP_108484.1, carboxylesterase, st 95.91
3bdi_A207 Uncharacterized protein TA0194; NP_393672.1, predi 95.9
3rm3_A270 MGLP, thermostable monoacylglycerol lipase; alpha/ 95.88
1mj5_A302 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; 95.88
3og9_A209 Protein YAHD A copper inducible hydrolase; alpha/b 95.86
2vat_A444 Acetyl-COA--deacetylcephalosporin C acetyltransfer 95.85
4f0j_A315 Probable hydrolytic enzyme; alpha/beta hydrolase f 95.83
2b61_A377 Homoserine O-acetyltransferase; acyl-enzyme, aspar 95.82
3ia2_A271 Arylesterase; alpha-beta hydrolase fold, transitio 95.82
1imj_A210 CIB, CCG1-interacting factor B; alpha/beta hydrola 95.82
1tgl_A269 Triacyl-glycerol acylhydrolase; carboxylic esteras 95.75
3fla_A267 RIFR; alpha-beta hydrolase thioesterase, hydrolase 95.74
1dqz_A280 85C, protein (antigen 85-C); fibronectin, structur 95.72
3u0v_A239 Lysophospholipase-like protein 1; alpha, beta hydr 95.71
3pfb_A270 Cinnamoyl esterase; alpha/beta hydrolase fold, hyd 95.68
2y6u_A398 Peroxisomal membrane protein LPX1; hydrolase, puta 95.64
2o2g_A223 Dienelactone hydrolase; YP_324580.1, structural ge 95.63
3b12_A304 Fluoroacetate dehalogenase; dehalogease, hydrolase 94.61
3cn9_A226 Carboxylesterase; alpha/beta hydrolase fold super- 95.61
3fob_A281 Bromoperoxidase; structural genomics, IDP00046, ba 95.6
3ils_A265 PKS, aflatoxin biosynthesis polyketide synthase; A 95.59
2e3j_A356 Epoxide hydrolase EPHB; epoxide hydrolase B, struc 95.58
2r11_A306 Carboxylesterase NP; 2632844, putative hydrolase, 95.58
2q0x_A335 Protein DUF1749, uncharacterized protein; alpha/be 95.57
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 95.55
1b6g_A310 Haloalkane dehalogenase; hydrolase, alpha/beta-hyd 95.53
3trd_A208 Alpha/beta hydrolase; cellular processes; 1.50A {C 95.51
2fuk_A220 XC6422 protein; A/B hydrolase, structural genomics 95.47
1w52_X452 Pancreatic lipase related protein 2; detergent, cl 95.47
1k8q_A377 Triacylglycerol lipase, gastric; APHA beta hydrola 95.41
2r8b_A251 AGR_C_4453P, uncharacterized protein ATU2452; APC6 95.33
1bu8_A452 Protein (pancreatic lipase related protein 2); hyd 95.32
3lcr_A319 Tautomycetin biosynthetic PKS; alpha-beta hydrolas 95.32
1tib_A269 Lipase; hydrolase(carboxylic esterase); 1.84A {The 95.28
3dkr_A251 Esterase D; alpha beta hydrolase, mechanism, catal 95.22
3kxp_A314 Alpha-(N-acetylaminomethylene)succinic acid hydrol 95.18
1tht_A305 Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. 95.18
3tej_A329 Enterobactin synthase component F; nonribosomal pe 95.07
2rau_A354 Putative esterase; NP_343859.1, putative lipase, s 95.04
1gpl_A432 RP2 lipase; serine esterase, hydrolase, lipid degr 95.04
1kez_A300 Erythronolide synthase; polyketide synthase, modul 94.97
1lgy_A269 Lipase, triacylglycerol lipase; hydrolase (carboxy 94.85
3tjm_A283 Fatty acid synthase; thioesterase domain, fatty ac 94.85
1sfr_A304 Antigen 85-A; alpha/beta hydrolase, structural gen 94.82
3e4d_A278 Esterase D; S-formylglutathione hydrolase, hydrola 94.82
2i3d_A249 AGR_C_3351P, hypothetical protein ATU1826; structu 94.8
1hpl_A449 Lipase; hydrolase(carboxylic esterase); 2.30A {Equ 94.8
3i6y_A280 Esterase APC40077; lipase, structural genomics, PS 94.8
1ufo_A238 Hypothetical protein TT1662; alpha-beta fold, hydr 94.74
3fcx_A282 FGH, esterase D, S-formylglutathione hydrolase; re 94.67
1jfr_A262 Lipase; serine hydrolase; 1.90A {Streptomyces exfo 94.59
1r88_A280 MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP 94.56
2uz0_A263 Esterase, tributyrin esterase; alpha/beta hydrolas 94.54
3d0k_A304 Putative poly(3-hydroxybutyrate) depolymerase LPQ; 94.52
2pbl_A262 Putative esterase/lipase/thioesterase; alpha/beta- 94.48
1jmk_C230 SRFTE, surfactin synthetase; thioesterase, non-rib 94.44
4b6g_A283 Putative esterase; hydrolase, formaldehyde detoxif 94.42
3ls2_A280 S-formylglutathione hydrolase; psychrophilic organ 94.4
1rp1_A450 Pancreatic lipase related protein 1; hydrolase, li 94.37
3n2z_B446 Lysosomal Pro-X carboxypeptidase; alpha/beta hydro 94.31
2cb9_A244 Fengycin synthetase; thioesterase, non-ribosomal p 94.16
1vkh_A273 Putative serine hydrolase; structural genomics, jo 94.16
3d7r_A326 Esterase; alpha/beta fold, hydrolase; 2.01A {Staph 94.1
3bxp_A277 Putative lipase/esterase; putative carboxylesteras 94.08
3qmv_A280 Thioesterase, REDJ; alpha/beta hydrolase fold, hyd 93.95
4h0c_A210 Phospholipase/carboxylesterase; PSI-biology, midwe 93.93
4i19_A388 Epoxide hydrolase; structural genomics, PSI-biolog 93.92
2hfk_A319 Pikromycin, type I polyketide synthase pikaiv; alp 93.67
1qlw_A328 Esterase; anisotropic refinement, atomic resolutio 93.54
3k2i_A422 Acyl-coenzyme A thioesterase 4; alpha/beta hydrola 93.54
1jjf_A268 Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x 93.37
3bjr_A283 Putative carboxylesterase; structural genomics, jo 93.25
1zi8_A236 Carboxymethylenebutenolidase; alpha and beta prote 93.19
4f21_A246 Carboxylesterase/phospholipase family protein; str 92.96
1tia_A279 Lipase; hydrolase(carboxylic esterase); 2.10A {Pen 92.9
4fle_A202 Esterase; structural genomics, PSI-biology, northe 92.88
3qpa_A197 Cutinase; alpha-beta hydrolase fold, esterase, hyd 92.88
3hlk_A446 Acyl-coenzyme A thioesterase 2, mitochondrial; alp 92.82
2dst_A131 Hypothetical protein TTHA1544; conserved hypotheti 92.63
1ycd_A243 Hypothetical 27.3 kDa protein in AAP1-SMF2 interge 92.54
2k2q_B242 Surfactin synthetase thioesterase subunit; A/B-hyd 92.51
3vis_A306 Esterase; alpha/beta-hydrolase fold, polyethylene 92.47
2hm7_A310 Carboxylesterase; alpha/beta hydrolase fold, hydro 92.43
3doh_A380 Esterase; alpha-beta hydrolase, beta sheet; 2.60A 92.42
3fcy_A346 Xylan esterase 1; alpha/beta hydrolase, carbohydra 92.4
2zsh_A351 Probable gibberellin receptor GID1L1; plant hormon 92.35
4fhz_A285 Phospholipase/carboxylesterase; alpha/beta hydrola 92.06
3vdx_A 456 Designed 16NM tetrahedral protein CAGE containing 92.04
3f67_A241 Putative dienelactone hydrolase; alpha-beta-alpha 92.01
4e15_A303 Kynurenine formamidase; alpha/beta hydrolase fold, 91.9
3hxk_A276 Sugar hydrolase; alpha-beta protein., structural g 91.88
3mve_A415 FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ 91.7
2fx5_A258 Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse 91.69
2hdw_A367 Hypothetical protein PA2218; alpha/beta hydrolase 91.51
2c7b_A311 Carboxylesterase, ESTE1; carboxyesterase, thermoph 91.5
1uwc_A261 Feruloyl esterase A; hydrolase, serine esterase, x 91.37
2px6_A316 Thioesterase domain; thioesaterse domain, orlistat 91.35
2o7r_A338 CXE carboxylesterase; alpha/beta hydrolase; 1.40A 91.31
1l7a_A318 Cephalosporin C deacetylase; structural genomics, 91.28
3o0d_A301 YALI0A20350P, triacylglycerol lipase; alpha/beta-h 91.27
3qpd_A187 Cutinase 1; alpha-beta hydrolase fold, esterase, h 91.26
3fnb_A405 Acylaminoacyl peptidase SMU_737; alpha-beta-alpha 90.88
2jbw_A386 Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine 90.58
1jji_A311 Carboxylesterase; alpha-beta hydrolase fold, hydro 90.49
1gkl_A297 Endo-1,4-beta-xylanase Y; hydrolase, esterase fami 90.39
3ngm_A319 Extracellular lipase; secret lipase, hydrolase; 2. 90.28
1vlq_A337 Acetyl xylan esterase; TM0077, structural genomics 90.05
3dcn_A201 Cutinase, cutin hydrolase; catalytic triad, secret 90.05
2czq_A205 Cutinase-like protein; alpha/beta hydrolase fold, 89.96
1lzl_A323 Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod 89.86
2wir_A313 Pesta, alpha/beta hydrolase fold-3 domain protein; 89.84
2z3z_A706 Dipeptidyl aminopeptidase IV; peptidase family S9, 89.51
3hc7_A254 Gene 12 protein, GP12; alpha/beta sandwich, cell a 89.43
3c8d_A403 Enterochelin esterase; alpha-beta-alpha sandwich, 89.08
3k6k_A322 Esterase/lipase; alpha/beta hydrolase fold; 2.20A 89.05
3o4h_A582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.94
2qm0_A275 BES; alpha-beta structure, structural genomics, PS 88.86
2ecf_A741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 88.7
1qoz_A207 AXE, acetyl xylan esterase; hydrolase, xylan degra 88.62
3fak_A322 Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc 88.56
1g66_A207 Acetyl xylan esterase II; serine hydrolase, acetyl 88.37
3aja_A302 Putative uncharacterized protein; alpha-beta hydro 87.96
1z68_A719 Fibroblast activation protein, alpha subunit; sepr 87.96
3d59_A383 Platelet-activating factor acetylhydrolase; secret 87.71
1jkm_A361 Brefeldin A esterase; serine hydrolase, degradatio 87.51
3g02_A408 Epoxide hydrolase; alpha/beta hydrolase fold, enan 87.28
2qru_A274 Uncharacterized protein; alpha/beta-hydrolase, str 86.63
3uue_A279 LIP1, secretory lipase (family 3); LID-domain, hyd 86.55
3azo_A662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 86.51
3ain_A323 303AA long hypothetical esterase; carboxylesterase 86.41
3g7n_A258 Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A 86.06
3h2g_A397 Esterase; xanthomonas oryzae PV. oryzae, cell WALL 85.2
4ezi_A377 Uncharacterized protein; alpha-beta hydrolases fol 85.17
3qh4_A317 Esterase LIPW; structural genomics, ssgcid, seattl 85.1
2xdw_A710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 85.05
2gzs_A278 IROE protein; enterobactin, salmochelin, DFP, hydr 85.02
4a5s_A740 Dipeptidyl peptidase 4 soluble form; hydrolase, ty 84.76
1xfd_A723 DIP, dipeptidyl aminopeptidase-like protein 6, dip 84.4
2bkl_A695 Prolyl endopeptidase; mechanistic study, celiac sp 84.29
3gff_A331 IROE-like serine hydrolase; NP_718593.1, structura 83.91
1yr2_A741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 83.78
3ga7_A326 Acetyl esterase; phosphoserine, IDP00896, hydrolas 83.64
3ebl_A365 Gibberellin receptor GID1; alpha/beta hydrolase, l 82.94
3iuj_A693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 81.77
3g8y_A391 SUSD/RAGB-associated esterase-like protein; struct 80.98
2ory_A346 Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph 80.55
>1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Back     alignment and structure
Probab=100.00  E-value=4.4e-48  Score=347.18  Aligned_cols=200  Identities=35%  Similarity=0.698  Sum_probs=188.7

Q ss_pred             CCCcccEEEeChhhHHHHHHHHhcCCCCCcceEEEecCCCCCcccccCCC--ChhHHHHHHHhHhhhcccHHhhhccccC
Q 025062            4 LSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG--SGIFCIIANNLIKAEVYSDYVQDHLAPS   81 (258)
Q Consensus         4 l~~GvnlIGhSQGGli~Rayiq~~~g~~kV~nlISLggPh~G~~~~P~c~--~~~lc~~~~~ll~~~~Y~~~vQ~~l~~A   81 (258)
                      +++++++|||||||+|+|+|+++|++ ++|++||++|+||+|+...|.|.  ...+|..+..+++...|++++|+.++++
T Consensus        78 l~~~~~lvGhSmGG~ia~~~a~~~~~-~~v~~lv~~~~p~~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~  156 (279)
T 1ei9_A           78 LQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERLVQA  156 (279)
T ss_dssp             GTTCEEEEEETTHHHHHHHHHHHCCS-SCEEEEEEESCCTTCBCSCTTCCSTTCHHHHHHHHHTHHHHTSHHHHHHCTGG
T ss_pred             ccCCEEEEEECHHHHHHHHHHHHcCC-cccceEEEecCccCCccCCCCCccccchHHHHHHHHhcccccChHHhcccccc
Confidence            55789999999999999999999985 57999999999999999999996  3567988888888888999999999999


Q ss_pred             CccCCCCChhhhhhcCcchHHHHcCCCCCCchhHHHhhhccCCeEEEEeCCCcEeecCCcCcccccCCCCCcccccCccc
Q 025062           82 GYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKT  161 (258)
Q Consensus        82 ~Y~rdP~~~~~yl~~S~FL~~LNne~~~~~n~~Yk~nf~~L~~~vli~~~~D~vV~P~eSs~Fg~y~~~~~~~vvpm~et  161 (258)
                      +||+||...++|+.+|.||++||++..  .+.+|++|+.+|+++++|.+++|++|+|++|+||++|.+++++.|+||++|
T Consensus       157 ~~~~d~~~~~~~~~~s~fl~~ln~~~~--~~~~~~~~l~~l~~~~li~g~~D~~v~p~~s~~~~~~~~~~~~~~~~~~~~  234 (279)
T 1ei9_A          157 EYWHDPIREDIYRNHSIFLADINQERG--VNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQES  234 (279)
T ss_dssp             GGBCCSTTHHHHHHHCSSHHHHTTTTS--CCHHHHHHHHTSSEEEEEEETTCSSSSSGGGGGTCEECTTCSSCEECGGGS
T ss_pred             ccccCchhHHHHHhcCcchhhhhhhhh--hhHHHHHHHHhhCccEEEecCCCceECCCccceeeEecCCCCceEechhhc
Confidence            999999999999999999999999973  678999999999999999999999999999999999998889999999999


Q ss_pred             ccccccccchHhHhhcCCeEEEeecCCcceecHHHHHHhhHhhhc
Q 025062          162 KLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  206 (258)
Q Consensus       162 ~~Y~eD~iGLktLde~G~l~f~~v~G~H~~~~~~~~~~~i~pyl~  206 (258)
                      .+|+|||+|||+||++|+++|++|||.||.+++++|.++|+|||.
T Consensus       235 ~~y~ed~~gl~~l~~~~~~~~~~v~g~H~~~~~~~~~~~i~~~l~  279 (279)
T 1ei9_A          235 TLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAHIIPFLE  279 (279)
T ss_dssp             HHHHTTSSSHHHHHHTTCEEEEEESSSTTCCCHHHHHHHTGGGTC
T ss_pred             chhHhhhhhHHHHHHCCCeEEEeccCchhccCHHHHHHHHHHhcC
Confidence            999999999999999999999999999999999999999999984



>1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Back     alignment and structure
>3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Back     alignment and structure
>2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Back     alignment and structure
>1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Back     alignment and structure
>3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} Back     alignment and structure
>3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} Back     alignment and structure
>3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} Back     alignment and structure
>2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A Back     alignment and structure
>2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} Back     alignment and structure
>1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 Back     alignment and structure
>1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E Back     alignment and structure
>1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Back     alignment and structure
>3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} Back     alignment and structure
>1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 Back     alignment and structure
>2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* Back     alignment and structure
>1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* Back     alignment and structure
>2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} Back     alignment and structure
>1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 Back     alignment and structure
>3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... Back     alignment and structure
>2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* Back     alignment and structure
>3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 Back     alignment and structure
>2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* Back     alignment and structure
>2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A Back     alignment and structure
>2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} Back     alignment and structure
>1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A Back     alignment and structure
>1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* Back     alignment and structure
>1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* Back     alignment and structure
>1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 Back     alignment and structure
>2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A Back     alignment and structure
>2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A Back     alignment and structure
>1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* Back     alignment and structure
>1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A Back     alignment and structure
>1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A Back     alignment and structure
>3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} Back     alignment and structure
>3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} Back     alignment and structure
>3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 Back     alignment and structure
>2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} Back     alignment and structure
>3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* Back     alignment and structure
>3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A Back     alignment and structure
>3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} Back     alignment and structure
>4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A Back     alignment and structure
>2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* Back     alignment and structure
>1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} Back     alignment and structure
>3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A Back     alignment and structure
>3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 Back     alignment and structure
>1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A Back     alignment and structure
>1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 Back     alignment and structure
>3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A Back     alignment and structure
>3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* Back     alignment and structure
>3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} Back     alignment and structure
>3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} Back     alignment and structure
>2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A Back     alignment and structure
>3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} Back     alignment and structure
>1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 Back     alignment and structure
>3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} Back     alignment and structure
>3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} Back     alignment and structure
>2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} Back     alignment and structure
>1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 Back     alignment and structure
>3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* Back     alignment and structure
>1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 Back     alignment and structure
>1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* Back     alignment and structure
>4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A Back     alignment and structure
>1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A Back     alignment and structure
>1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 Back     alignment and structure
>3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} Back     alignment and structure
>3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} Back     alignment and structure
>2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 Back     alignment and structure
>3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} Back     alignment and structure
>3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* Back     alignment and structure
>3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} Back     alignment and structure
>3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} Back     alignment and structure
>1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 Back     alignment and structure
>3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A Back     alignment and structure
>3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P Back     alignment and structure
>3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} Back     alignment and structure
>2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} Back     alignment and structure
>3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A Back     alignment and structure
>2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A Back     alignment and structure
>2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 Back     alignment and structure
>2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A Back     alignment and structure
>3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} Back     alignment and structure
>2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* Back     alignment and structure
>2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} Back     alignment and structure
>1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 Back     alignment and structure
>4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A Back     alignment and structure
>3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 Back     alignment and structure
>3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} Back     alignment and structure
>3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A Back     alignment and structure
>1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A Back     alignment and structure
>3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 Back     alignment and structure
>2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* Back     alignment and structure
>4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 Back     alignment and structure
>3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A Back     alignment and structure
>1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 Back     alignment and structure
>1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A Back     alignment and structure
>3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* Back     alignment and structure
>1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* Back     alignment and structure
>3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} Back     alignment and structure
>3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* Back     alignment and structure
>2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* Back     alignment and structure
>2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} Back     alignment and structure
>3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A Back     alignment and structure
>3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* Back     alignment and structure
>3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 Back     alignment and structure
>3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} Back     alignment and structure
>2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* Back     alignment and structure
>2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} Back     alignment and structure
>2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A Back     alignment and structure
>3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} Back     alignment and structure
>2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 Back     alignment and structure
>1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} Back     alignment and structure
>1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* Back     alignment and structure
>2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 Back     alignment and structure
>1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* Back     alignment and structure
>3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} Back     alignment and structure
>1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* Back     alignment and structure
>3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A Back     alignment and structure
>3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} Back     alignment and structure
>1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 Back     alignment and structure
>3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A Back     alignment and structure
>2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} Back     alignment and structure
>1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A Back     alignment and structure
>1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A Back     alignment and structure
>1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A Back     alignment and structure
>3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A Back     alignment and structure
>1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 Back     alignment and structure
>2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 Back     alignment and structure
>1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 Back     alignment and structure
>3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A Back     alignment and structure
>1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 Back     alignment and structure
>3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 Back     alignment and structure
>1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 Back     alignment and structure
>1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 Back     alignment and structure
>2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} Back     alignment and structure
>3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} Back     alignment and structure
>2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 Back     alignment and structure
>1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 Back     alignment and structure
>4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} Back     alignment and structure
>3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 Back     alignment and structure
>1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A Back     alignment and structure
>3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} Back     alignment and structure
>2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* Back     alignment and structure
>1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 Back     alignment and structure
>3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} Back     alignment and structure
>3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* Back     alignment and structure
>3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* Back     alignment and structure
>4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} Back     alignment and structure
>4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} Back     alignment and structure
>2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A Back     alignment and structure
>1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* Back     alignment and structure
>3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} Back     alignment and structure
>1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* Back     alignment and structure
>3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* Back     alignment and structure
>4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} Back     alignment and structure
>1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 Back     alignment and structure
>4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} Back     alignment and structure
>3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... Back     alignment and structure
>3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} Back     alignment and structure
>2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 Back     alignment and structure
>1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A Back     alignment and structure
>3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} Back     alignment and structure
>2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A Back     alignment and structure
>3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A Back     alignment and structure
>3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} Back     alignment and structure
>2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* Back     alignment and structure
>4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* Back     alignment and structure
>3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A Back     alignment and structure
>3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A Back     alignment and structure
>3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} Back     alignment and structure
>3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A Back     alignment and structure
>2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} Back     alignment and structure
>2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} Back     alignment and structure
>2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} Back     alignment and structure
>1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* Back     alignment and structure
>2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} Back     alignment and structure
>2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A Back     alignment and structure
>1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* Back     alignment and structure
>3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 Back     alignment and structure
>3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A Back     alignment and structure
>3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} Back     alignment and structure
>2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 Back     alignment and structure
>1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 Back     alignment and structure
>1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* Back     alignment and structure
>3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} Back     alignment and structure
>1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* Back     alignment and structure
>3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* Back     alignment and structure
>2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} Back     alignment and structure
>1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} Back     alignment and structure
>3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* Back     alignment and structure
>3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 Back     alignment and structure
>3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A Back     alignment and structure
>1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* Back     alignment and structure
>3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} Back     alignment and structure
>1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} Back     alignment and structure
>3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* Back     alignment and structure
>1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 Back     alignment and structure
>3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* Back     alignment and structure
>2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} Back     alignment and structure
>3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A Back     alignment and structure
>3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} Back     alignment and structure
>3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A Back     alignment and structure
>4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} Back     alignment and structure
>3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* Back     alignment and structure
>4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... Back     alignment and structure
>1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} Back     alignment and structure
>3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} Back     alignment and structure
>2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 258
d1ei9a_279 c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {C 5e-91
d1pjaa_268 c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H 2e-29
d1ispa_179 c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 0.001
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 279 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Thioesterases
domain: Palmitoyl protein thioesterase 1
species: Cow (Bos taurus) [TaxId: 9913]
 Score =  268 bits (686), Expect = 5e-91
 Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 5/208 (2%)

Query: 1   MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLC--GSGIFC 58
             +L +GYN +G SQG    R V + C   PP+ N +S+GG H G   +P C   S   C
Sbjct: 75  DPKLQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHIC 133

Query: 59  IIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKEC 118
                 + A  Y+  +Q+ L  + Y   P     Y     FL  +N E     N +YK+ 
Sbjct: 134 DFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQERG--VNESYKKN 191

Query: 119 FSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAG 178
             +L+  V++ F +D ++ P ++ WFG+Y  G     +P Q++ LYT+D +GLK +D AG
Sbjct: 192 LMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKAG 251

Query: 179 RVHFISVAGGHLKISKADMKKHIIPYLK 206
           ++ F+++ G HL++S+     HIIP+L+
Sbjct: 252 QLVFLALEGDHLQLSEEWFYAHIIPFLE 279


>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query258
d1ei9a_279 Palmitoyl protein thioesterase 1 {Cow (Bos taurus) 100.0
d1pjaa_268 Palmitoyl protein thioesterase 2 {Human (Homo sapi 99.94
d1tcaa_317 Triacylglycerol lipase {Yeast (Candida antarctica) 99.4
d1ispa_179 Lipase A {Bacillus subtilis [TaxId: 1423]} 98.91
d1ku0a_388 Lipase L1 {Bacillus stearothermophilus [TaxId: 142 98.56
d1ex9a_285 Lipase {Pseudomonas aeruginosa [TaxId: 287]} 98.48
d1cvla_319 Lipase {Chromobacterium viscosum [TaxId: 42739]} 98.34
d1hkha_279 Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] 97.5
d1jmkc_230 Surfactin synthetase, SrfA {Bacillus subtilis [Tax 97.42
d1m33a_256 Biotin biosynthesis protein BioH {Escherichia coli 97.33
d1zd3a2322 Mammalian epoxide hydrolase, C-terminal domain {Hu 96.67
d1mtza_290 Tricorn interacting factor F1 {Archaeon Thermoplas 96.64
d1brta_277 Bromoperoxidase A2 {Streptomyces aureofaciens [Tax 96.55
d3c70a1256 Hydroxynitrile lyase {Rubber tree (Hevea brasilien 96.55
d1c4xa_281 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 96.49
d1q0ra_297 Aclacinomycin methylesterase RdmC {Streptomyces pu 96.35
d1j1ia_268 Meta cleavage compound hydrolase CarC {Janthinobac 96.26
d1ehya_293 Bacterial epoxide hydrolase {Agrobacterium radioba 96.19
d1uxoa_186 Hypothetical protein YdeN {Bacillus subtilis [TaxI 96.09
d2rhwa1283 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas 96.05
d1uk8a_271 Meta-cleavage product hydrolase CumD {Pseudomonas 96.0
d1b6ga_310 Haloalkane dehalogenase {Xanthobacter autotrophicu 95.96
d1mj5a_298 Haloalkane dehalogenase {Sphingomonas paucimobilis 95.83
d1imja_208 Ccg1/TafII250-interacting factor B (Cib) {Human (H 95.78
d1xkla_258 Salicylic acid-binding protein 2 (SABP2) {Common t 95.57
d1bn7a_291 Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 95.4
d1azwa_313 Proline iminopeptidase {Xanthomonas campestris, pv 95.2
d1xkta_286 Fatty acid synthase {Human (Homo sapiens) [TaxId: 95.18
d1a8qa_274 Bromoperoxidase A1 {Streptomyces aureofaciens [Tax 95.08
d1k8qa_377 Gastric lipase {Dog (Canis familiaris) [TaxId: 961 95.03
d1r3da_264 Hypothetical protein VC1974 {Vibrio cholerae [TaxI 94.97
d3b5ea1209 Uncharacterized protein Mll8374 {Mesorhizobium lot 93.53
d1fj2a_229 Acyl protein thioesterase 1 {Human (Homo sapiens) 93.28
d2h7xa1283 Picromycin polyketide synthase {Streptomyces venez 93.24
d1cexa_197 Cutinase {Fungus (Fusarium solani), subsp. pisi [T 92.92
d1va4a_271 Arylesterase {Pseudomonas fluorescens [TaxId: 294] 92.47
d1tqha_242 Carboxylesterase Est {Bacillus stearothermophilus 92.4
d1a88a_275 Chloroperoxidase L {Streptomyces lividans [TaxId: 92.33
d1thta_302 Myristoyl-ACP-specific thioesterase {Vibrio harvey 91.84
d1mo2a_255 Erythromycin polyketide synthase {Saccharopolyspor 90.54
d1tiba_269 Triacylglycerol lipase {Thermomyces lanuginosus, f 90.14
d1a8sa_273 Chloroperoxidase F {Pseudomonas fluorescens [TaxId 89.95
d2b61a1357 Homoserine O-acetyltransferase {Haemophilus influe 89.82
d1auoa_218 Carboxylesterase {Pseudomonas fluorescens [TaxId: 89.8
d2pl5a1362 Homoserine O-acetyltransferase {Leptospira interro 89.79
d2h1ia1202 Carboxylesterase {Bacillus cereus [TaxId: 1396]} 89.76
d1uwca_261 Feruloyl esterase A {Aspergillus niger [TaxId: 506 89.66
d2vata1376 Acetyl-CoA:deacetylcephalosporin C acetyltransfera 89.63
d1bu8a2338 Pancreatic lipase, N-terminal domain {Rat (Rattus 89.47
d2r8ba1203 Uncharacterized protein Atu2452 {Agrobacterium tum 89.06
d2fuka1218 XC6422 protein {Xanthomonas campestris [TaxId: 339 89.03
d2jbwa1360 2,6-dihydropseudooxynicotine hydrolase {Arthrobact 88.69
d1rp1a2337 Pancreatic lipase, N-terminal domain {Dog (Canis f 87.98
d1wb4a1273 Feruloyl esterase domain of the cellulosomal xylan 87.22
d1jjfa_255 Feruloyl esterase domain of the cellulosomal xylan 87.16
d1tiaa_271 Triacylglycerol lipase {Penicillium camembertii [T 87.16
d1lgya_265 Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 87.13
d1g66a_207 Acetylxylan esterase {Penicillium purpurogenum [Ta 86.32
d1qoza_207 Acetylxylan esterase {Trichoderma reesei [TaxId: 5 85.86
d3tgla_265 Triacylglycerol lipase {Rhizomucor miehei [TaxId: 85.53
d1xfda2258 Dipeptidyl aminopeptidase-like protein 6, DPP6, C- 85.17
d1wm1a_313 Proline aminopeptidase {Serratia marcescens [TaxId 84.73
d3c8da2246 Enterochelin esterase, catalytic domain {Shigella 83.1
d1sfra_288 Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 82.59
d1dqza_280 Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 82.34
d1ufoa_238 Hypothetical protein TT1662 {Thermus thermophilus 80.9
>d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: alpha/beta-Hydrolases
superfamily: alpha/beta-Hydrolases
family: Thioesterases
domain: Palmitoyl protein thioesterase 1
species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00  E-value=2.4e-74  Score=524.96  Aligned_cols=203  Identities=34%  Similarity=0.684  Sum_probs=195.8

Q ss_pred             CccCCCcccEEEeChhhHHHHHHHHhcCCCCCcceEEEecCCCCCcccccCCC--ChhHHHHHHHhHhhhcccHHhhhcc
Q 025062            1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG--SGIFCIIANNLIKAEVYSDYVQDHL   78 (258)
Q Consensus         1 ~~~l~~GvnlIGhSQGGli~Rayiq~~~g~~kV~nlISLggPh~G~~~~P~c~--~~~lc~~~~~ll~~~~Y~~~vQ~~l   78 (258)
                      ++++++|||+|||||||+|+|+|+|+|++ ++|++||||||||+|++++|.|.  ++++|++++.+++..+|++++|+++
T Consensus        75 ~~~~~~~v~lVGhSqGGLiaR~~i~~~~~-~~V~~lITLgsPH~Gv~~~p~c~~~~~~~c~~~~~~l~~~~y~~~~Q~~l  153 (279)
T d1ei9a_          75 DPKLQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERL  153 (279)
T ss_dssp             CGGGTTCEEEEEETTHHHHHHHHHHHCCS-SCEEEEEEESCCTTCBCSCTTCCSTTCHHHHHHHHHTHHHHTSHHHHHHC
T ss_pred             ccccccceeEEEEccccHHHHHHHHHcCC-CCcceEEEECCCCCCccCCccCCCcchhHHHHHHHHHHhhhhHHHHhhce
Confidence            35778999999999999999999999996 69999999999999999999996  5799999999999999999999999


Q ss_pred             ccCCccCCCCChhhhhhcCcchHHHHcCCCCCCchhHHHhhhccCCeEEEEeCCCcEeecCCcCcccccCCCCCcccccC
Q 025062           79 APSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPP  158 (258)
Q Consensus        79 ~~A~Y~rdP~~~~~yl~~S~FL~~LNne~~~~~n~~Yk~nf~~L~~~vli~~~~D~vV~P~eSs~Fg~y~~~~~~~vvpm  158 (258)
                      ++|||||||.++++|+++|.|||+||||+  ..|.+||+||.+|++||||+|++|+||+||||||||||++++.++||||
T Consensus       154 ~~a~Yw~dp~~~~~Y~~~s~fL~~iNne~--~~n~~~k~nl~~l~~~vli~~~~D~vv~P~eSs~f~~y~~~~~~~v~~~  231 (279)
T d1ei9a_         154 VQAEYWHDPIREDIYRNHSIFLADINQER--GVNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPL  231 (279)
T ss_dssp             TGGGGBCCSTTHHHHHHHCSSHHHHTTTT--SCCHHHHHHHHTSSEEEEEEETTCSSSSSGGGGGTCEECTTCSSCEECG
T ss_pred             eccchhcCcchHhhhhhhhhHHHHHhCCc--cCChHHHHHHHhhccEEEEEeCCCceECCCCcceeeeccCCCCceEech
Confidence            99999999999999999999999999997  5699999999999999999999999999999999999998887899999


Q ss_pred             cccccccccccchHhHhhcCCeEEEeecCCcceecHHHHHHhhHhhhc
Q 025062          159 QKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK  206 (258)
Q Consensus       159 ~et~~Y~eD~iGLktLde~G~l~f~~v~G~H~~~~~~~~~~~i~pyl~  206 (258)
                      +||++|+||||||||||++|||+|+++||+||+|++++|.++|+|||+
T Consensus       232 ~~~~~Y~~D~~GLk~ld~~g~l~~~~~~g~H~~~~~~~~~~~i~~~L~  279 (279)
T d1ei9a_         232 QESTLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAHIIPFLE  279 (279)
T ss_dssp             GGSHHHHTTSSSHHHHHHTTCEEEEEESSSTTCCCHHHHHHHTGGGTC
T ss_pred             hhcccHhhhhhCHHhHHHCCCeEEEEeCCccceecHHHHHHhhHhhcC
Confidence            999999999999999999999999999999999999999999999995



>d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} Back     information, alignment and structure
>d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} Back     information, alignment and structure
>d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} Back     information, alignment and structure
>d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} Back     information, alignment and structure
>d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} Back     information, alignment and structure
>d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} Back     information, alignment and structure
>d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} Back     information, alignment and structure
>d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} Back     information, alignment and structure
>d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} Back     information, alignment and structure
>d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} Back     information, alignment and structure
>d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} Back     information, alignment and structure
>d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} Back     information, alignment and structure
>d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} Back     information, alignment and structure
>d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} Back     information, alignment and structure
>d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} Back     information, alignment and structure
>d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} Back     information, alignment and structure
>d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} Back     information, alignment and structure
>d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} Back     information, alignment and structure
>d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} Back     information, alignment and structure
>d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} Back     information, alignment and structure
>d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} Back     information, alignment and structure
>d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} Back     information, alignment and structure
>d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} Back     information, alignment and structure
>d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} Back     information, alignment and structure
>d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure