Citrus Sinensis ID: 025062
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 118483969 | 366 | unknown [Populus trichocarpa] | 0.996 | 0.702 | 0.692 | 1e-108 | |
| 224138676 | 341 | predicted protein [Populus trichocarpa] | 0.961 | 0.727 | 0.723 | 1e-108 | |
| 255581315 | 327 | Palmitoyl-protein thioesterase 1 precurs | 0.980 | 0.773 | 0.696 | 1e-105 | |
| 296084707 | 309 | unnamed protein product [Vitis vinifera] | 0.930 | 0.776 | 0.720 | 1e-104 | |
| 356497117 | 367 | PREDICTED: palmitoyl-protein thioesteras | 0.996 | 0.700 | 0.676 | 1e-103 | |
| 359474403 | 301 | PREDICTED: palmitoyl-protein thioesteras | 0.926 | 0.794 | 0.719 | 1e-103 | |
| 428229698 | 357 | palmitoyl-protein thioesterase [Phaseolu | 0.984 | 0.711 | 0.701 | 1e-103 | |
| 224074193 | 352 | predicted protein [Populus trichocarpa] | 0.980 | 0.718 | 0.713 | 1e-103 | |
| 118482307 | 394 | unknown [Populus trichocarpa] | 0.976 | 0.639 | 0.707 | 1e-102 | |
| 357482125 | 327 | Palmitoyl-protein thioesterase [Medicago | 0.813 | 0.642 | 0.804 | 9e-99 |
| >gi|118483969|gb|ABK93872.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 397 bits (1021), Expect = e-108, Method: Compositional matrix adjust.
Identities = 189/273 (69%), Positives = 228/273 (83%), Gaps = 16/273 (5%)
Query: 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCII 60
MKELS+GY+IVGLSQGNLIGRGVVEFC+GGPPVKNF+SLGGPHAGTASVPLCGSGIFC +
Sbjct: 89 MKELSKGYSIVGLSQGNLIGRGVVEFCDGGPPVKNFISLGGPHAGTASVPLCGSGIFCKL 148
Query: 61 ANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS 120
A+ LIK+++YSDYVQ HLAPSGYLKFPNDIP Y+EKC+FLPKLNNE+P++RN+TYKE FS
Sbjct: 149 ADALIKSKIYSDYVQAHLAPSGYLKFPNDIPHYMEKCRFLPKLNNEIPEERNTTYKERFS 208
Query: 121 SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV 180
SLQNLVLIMF++D VLIPKET+WFGYYPDGAF P++P +T LYTEDWIGLK LD+AGRV
Sbjct: 209 SLQNLVLIMFENDNVLIPKETSWFGYYPDGAFKPIVPAHQTALYTEDWIGLKALDEAGRV 268
Query: 181 HFISVAGGHLKISKADMKKHIIPYLKDQASV------------RVI----ESRKTKGPNE 224
HF++V+GGHL IS++DMKKH++P+L D+ASV R I ++ G
Sbjct: 269 HFVNVSGGHLGISESDMKKHVVPFLVDEASVEKYSNARAHGLPRTITQNYHRKQVAGSFI 328
Query: 225 EEGSTELVFDGSSSYVWPSSVKSFFVELLEVSR 257
+E S E + DGSSSY WPSSVK+FF EL+ ++
Sbjct: 329 DETSNERILDGSSSYQWPSSVKNFFRELVGLAE 361
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224138676|ref|XP_002326662.1| predicted protein [Populus trichocarpa] gi|222833984|gb|EEE72461.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|255581315|ref|XP_002531468.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus communis] gi|223528922|gb|EEF30918.1| Palmitoyl-protein thioesterase 1 precursor, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|296084707|emb|CBI25849.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|356497117|ref|XP_003517409.1| PREDICTED: palmitoyl-protein thioesterase 1-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|359474403|ref|XP_002269785.2| PREDICTED: palmitoyl-protein thioesterase 1-like, partial [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|428229698|gb|AFY98638.1| palmitoyl-protein thioesterase [Phaseolus vulgaris] | Back alignment and taxonomy information |
|---|
| >gi|224074193|ref|XP_002304295.1| predicted protein [Populus trichocarpa] gi|222841727|gb|EEE79274.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|118482307|gb|ABK93080.1| unknown [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357482125|ref|XP_003611348.1| Palmitoyl-protein thioesterase [Medicago truncatula] gi|355512683|gb|AES94306.1| Palmitoyl-protein thioesterase [Medicago truncatula] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| TAIR|locus:2171554 | 314 | AT5G47330 [Arabidopsis thalian | 0.860 | 0.707 | 0.653 | 1.5e-83 | |
| TAIR|locus:2081942 | 338 | AT3G60340 [Arabidopsis thalian | 0.810 | 0.618 | 0.7 | 3.1e-83 | |
| TAIR|locus:2171564 | 317 | AT5G47340 [Arabidopsis thalian | 0.860 | 0.700 | 0.592 | 4e-74 | |
| TAIR|locus:2129066 | 308 | AT4G17470 [Arabidopsis thalian | 0.802 | 0.672 | 0.641 | 1.7e-73 | |
| TAIR|locus:2129076 | 304 | AT4G17480 [Arabidopsis thalian | 0.786 | 0.667 | 0.615 | 1.1e-71 | |
| TAIR|locus:2171599 | 316 | AT5G47350 [Arabidopsis thalian | 0.860 | 0.702 | 0.573 | 4.3e-70 | |
| TAIR|locus:2129086 | 300 | AT4G17483 [Arabidopsis thalian | 0.794 | 0.683 | 0.619 | 7e-70 | |
| DICTYBASE|DDB_G0285533 | 303 | ppt1 "palmitoyl-protein thioes | 0.786 | 0.669 | 0.429 | 1.6e-40 | |
| WB|WBGene00004092 | 298 | ppt-1 [Caenorhabditis elegans | 0.763 | 0.661 | 0.417 | 3.7e-39 | |
| CGD|CAL0000194 | 316 | orf19.540 [Candida albicans (t | 0.751 | 0.613 | 0.393 | 6.7e-33 |
| TAIR|locus:2171554 AT5G47330 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 837 (299.7 bits), Expect = 1.5e-83, P = 1.5e-83
Identities = 145/222 (65%), Positives = 186/222 (83%)
Query: 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCGSGIFCII 60
MKELS+GYNIVG SQGNL+ RG++EFC+GGPPV N++SL GPHAG +SVP+CGSG+FC +
Sbjct: 90 MKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSVPMCGSGLFCKL 149
Query: 61 ANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFS 120
A+ LIK ++YSD++QDHLAPSGYLK P D+ KYL K+LPKLNNE+PD+RN TYK+ F+
Sbjct: 150 ADELIKGDIYSDFIQDHLAPSGYLKIPTDMTKYLGSSKYLPKLNNEIPDQRNQTYKDRFT 209
Query: 121 SLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGRV 180
SL NLVLI F+ DKV++PK+++WFG+YPDG F P+L Q+TKLYTEDWIGLKTLDDAG+V
Sbjct: 210 SLHNLVLIKFQGDKVIVPKDSSWFGFYPDGEFEPLLSAQQTKLYTEDWIGLKTLDDAGKV 269
Query: 181 HFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGP 222
F+SVAG H+++ D+ KH++PYL+DQ S +RKTK P
Sbjct: 270 KFVSVAGEHIRMVDEDVVKHVVPYLQDQPSSVQSFNRKTKQP 311
|
|
| TAIR|locus:2081942 AT3G60340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171564 AT5G47340 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129066 AT4G17470 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129076 AT4G17480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2171599 AT5G47350 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2129086 AT4G17483 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| DICTYBASE|DDB_G0285533 ppt1 "palmitoyl-protein thioesterase 1" [Dictyostelium discoideum (taxid:44689)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00004092 ppt-1 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| CGD|CAL0000194 orf19.540 [Candida albicans (taxid:5476)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| PLN02633 | 314 | PLN02633, PLN02633, palmitoyl protein thioesterase | 1e-123 | |
| PLN02606 | 306 | PLN02606, PLN02606, palmitoyl-protein thioesterase | 1e-105 | |
| pfam02089 | 279 | pfam02089, Palm_thioest, Palmitoyl protein thioest | 5e-37 | |
| COG1075 | 336 | COG1075, LipA, Predicted acetyltransferases and hy | 0.004 |
| >gnl|CDD|178240 PLN02633, PLN02633, palmitoyl protein thioesterase family protein | Back alignment and domain information |
|---|
Score = 353 bits (906), Expect = e-123
Identities = 142/223 (63%), Positives = 184/223 (82%), Gaps = 1/223 (0%)
Query: 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG-SGIFCI 59
MKELS+GYNIVG SQGNL+ RG++EFC+GGPPV N++SL GPHAG +S+P CG SG+ C
Sbjct: 89 MKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSLPRCGTSGLICK 148
Query: 60 IANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECF 119
IAN LIK +VYSD++QDHLAPSGY K P D+ +YL+ K+LPKLNNE+PD+RN TYK+ F
Sbjct: 149 IANELIKGDVYSDFIQDHLAPSGYYKIPKDVTEYLKGSKYLPKLNNEIPDQRNQTYKDRF 208
Query: 120 SSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAGR 179
+SLQNLVL+ F++D V++PK+++WFG+YPDG F +L Q+TKLYTEDWIGLKTLDDAG+
Sbjct: 209 TSLQNLVLVKFQNDTVIVPKDSSWFGFYPDGEFEHLLSVQQTKLYTEDWIGLKTLDDAGK 268
Query: 180 VHFISVAGGHLKISKADMKKHIIPYLKDQASVRVIESRKTKGP 222
V F+SV GGHL ++ D+ K+++PYL+DQ S +RKTK P
Sbjct: 269 VKFVSVPGGHLIMADEDVVKYVVPYLQDQQSAAQRLNRKTKEP 311
|
Length = 314 |
| >gnl|CDD|215326 PLN02606, PLN02606, palmitoyl-protein thioesterase | Back alignment and domain information |
|---|
| >gnl|CDD|202109 pfam02089, Palm_thioest, Palmitoyl protein thioesterase | Back alignment and domain information |
|---|
| >gnl|CDD|224001 COG1075, LipA, Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| PLN02633 | 314 | palmitoyl protein thioesterase family protein | 100.0 | |
| PLN02606 | 306 | palmitoyl-protein thioesterase | 100.0 | |
| KOG2541 | 296 | consensus Palmitoyl protein thioesterase [Lipid tr | 100.0 | |
| PF02089 | 279 | Palm_thioest: Palmitoyl protein thioesterase; Inte | 100.0 | |
| PF01674 | 219 | Lipase_2: Lipase (class 2); InterPro: IPR002918 Li | 99.45 | |
| PF05057 | 217 | DUF676: Putative serine esterase (DUF676); InterPr | 98.81 | |
| PF07819 | 225 | PGAP1: PGAP1-like protein; InterPro: IPR012908 The | 98.52 | |
| COG1075 | 336 | LipA Predicted acetyltransferases and hydrolases w | 98.5 | |
| PF06028 | 255 | DUF915: Alpha/beta hydrolase of unknown function ( | 98.44 | |
| PF02450 | 389 | LCAT: Lecithin:cholesterol acyltransferase; InterP | 98.1 | |
| PLN02733 | 440 | phosphatidylcholine-sterol O-acyltransferase | 98.01 | |
| KOG3724 | 973 | consensus Negative regulator of COPII vesicle form | 97.32 | |
| COG4814 | 288 | Uncharacterized protein with an alpha/beta hydrola | 97.24 | |
| PF00561 | 230 | Abhydrolase_1: alpha/beta hydrolase fold A web pag | 97.19 | |
| PF12697 | 228 | Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3 | 96.65 | |
| PLN02965 | 255 | Probable pheophorbidase | 96.57 | |
| cd00741 | 153 | Lipase Lipase. Lipases are esterases that can hydr | 96.54 | |
| PLN02211 | 273 | methyl indole-3-acetate methyltransferase | 96.34 | |
| PLN02824 | 294 | hydrolase, alpha/beta fold family protein | 96.21 | |
| TIGR01836 | 350 | PHA_synth_III_C poly(R)-hydroxyalkanoic acid synth | 96.17 | |
| PRK10985 | 324 | putative hydrolase; Provisional | 96.13 | |
| TIGR03343 | 282 | biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-die | 96.12 | |
| PRK10349 | 256 | carboxylesterase BioH; Provisional | 96.1 | |
| PLN02517 | 642 | phosphatidylcholine-sterol O-acyltransferase | 95.95 | |
| PRK10749 | 330 | lysophospholipase L2; Provisional | 95.82 | |
| PRK11126 | 242 | 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxyl | 95.82 | |
| TIGR03056 | 278 | bchO_mg_che_rel putative magnesium chelatase acces | 95.81 | |
| PRK10673 | 255 | acyl-CoA esterase; Provisional | 95.76 | |
| TIGR01250 | 288 | pro_imino_pep_2 proline-specific peptidases, Bacil | 95.75 | |
| PLN02578 | 354 | hydrolase | 95.73 | |
| PLN03087 | 481 | BODYGUARD 1 domain containing hydrolase; Provision | 95.71 | |
| KOG4372 | 405 | consensus Predicted alpha/beta hydrolase [General | 95.67 | |
| TIGR01607 | 332 | PST-A Plasmodium subtelomeric family (PST-A). Thes | 95.65 | |
| PRK08775 | 343 | homoserine O-acetyltransferase; Provisional | 95.61 | |
| TIGR02240 | 276 | PHA_depoly_arom poly(3-hydroxyalkanoate) depolymer | 95.54 | |
| TIGR03695 | 251 | menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene | 95.52 | |
| PF12695 | 145 | Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3 | 95.51 | |
| PRK03592 | 295 | haloalkane dehalogenase; Provisional | 95.5 | |
| TIGR01738 | 245 | bioH putative pimeloyl-BioC--CoA transferase BioH. | 95.48 | |
| TIGR02427 | 251 | protocat_pcaD 3-oxoadipate enol-lactonase. Members | 95.45 | |
| PRK00870 | 302 | haloalkane dehalogenase; Provisional | 95.45 | |
| TIGR01392 | 351 | homoserO_Ac_trn homoserine O-acetyltransferase. Th | 95.3 | |
| PHA02857 | 276 | monoglyceride lipase; Provisional | 95.25 | |
| PRK03204 | 286 | haloalkane dehalogenase; Provisional | 95.21 | |
| PLN02298 | 330 | hydrolase, alpha/beta fold family protein | 95.17 | |
| COG2267 | 298 | PldB Lysophospholipase [Lipid metabolism] | 95.13 | |
| KOG2369 | 473 | consensus Lecithin:cholesterol acyltransferase (LC | 95.12 | |
| cd00707 | 275 | Pancreat_lipase_like Pancreatic lipase-like enzyme | 95.08 | |
| TIGR03611 | 257 | RutD pyrimidine utilization protein D. This protei | 95.06 | |
| COG0596 | 282 | MhpC Predicted hydrolases or acyltransferases (alp | 94.77 | |
| PRK06489 | 360 | hypothetical protein; Provisional | 94.65 | |
| PF02230 | 216 | Abhydrolase_2: Phospholipase/Carboxylesterase; Int | 94.6 | |
| PLN02511 | 388 | hydrolase | 94.36 | |
| PLN02894 | 402 | hydrolase, alpha/beta fold family protein | 94.31 | |
| PLN02385 | 349 | hydrolase; alpha/beta fold family protein | 94.02 | |
| PRK07581 | 339 | hypothetical protein; Validated | 94.02 | |
| TIGR03230 | 442 | lipo_lipase lipoprotein lipase. Members of this pr | 93.78 | |
| PRK14875 | 371 | acetoin dehydrogenase E2 subunit dihydrolipoyllysi | 93.71 | |
| TIGR01840 | 212 | esterase_phb esterase, PHB depolymerase family. Th | 93.5 | |
| PF01764 | 140 | Lipase_3: Lipase (class 3); InterPro: IPR002921 Tr | 93.39 | |
| KOG4409 | 365 | consensus Predicted hydrolase/acyltransferase (alp | 93.21 | |
| PF11288 | 207 | DUF3089: Protein of unknown function (DUF3089); In | 93.21 | |
| PRK00175 | 379 | metX homoserine O-acetyltransferase; Provisional | 93.19 | |
| PRK07868 | 994 | acyl-CoA synthetase; Validated | 93.1 | |
| TIGR01249 | 306 | pro_imino_pep_1 proline iminopeptidase, Neisseria- | 93.0 | |
| PRK06765 | 389 | homoserine O-acetyltransferase; Provisional | 92.77 | |
| PLN02679 | 360 | hydrolase, alpha/beta fold family protein | 92.67 | |
| TIGR03101 | 266 | hydr2_PEP hydrolase, ortholog 2, exosortase system | 92.63 | |
| PF01083 | 179 | Cutinase: Cutinase; InterPro: IPR000675 Aerial pla | 92.56 | |
| PRK11460 | 232 | putative hydrolase; Provisional | 92.15 | |
| KOG2029 | 697 | consensus Uncharacterized conserved protein [Funct | 91.91 | |
| cd00519 | 229 | Lipase_3 Lipase (class 3). Lipases are esterases t | 91.78 | |
| PF00975 | 229 | Thioesterase: Thioesterase domain; InterPro: IPR00 | 91.64 | |
| PF06259 | 177 | Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR | 91.46 | |
| PF03959 | 212 | FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 | 91.03 | |
| TIGR01839 | 560 | PHA_synth_II poly(R)-hydroxyalkanoic acid synthase | 90.94 | |
| PF08237 | 225 | PE-PPE: PE-PPE domain; InterPro: IPR013228 The hum | 90.79 | |
| TIGR02821 | 275 | fghA_ester_D S-formylglutathione hydrolase. This m | 90.68 | |
| TIGR01838 | 532 | PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, | 90.65 | |
| KOG1454 | 326 | consensus Predicted hydrolase/acyltransferase (alp | 90.6 | |
| PLN02652 | 395 | hydrolase; alpha/beta fold family protein | 90.53 | |
| PRK11071 | 190 | esterase YqiA; Provisional | 90.45 | |
| PRK05077 | 414 | frsA fermentation/respiration switch protein; Revi | 90.19 | |
| PLN02980 | 1655 | 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesi | 90.18 | |
| PF05990 | 233 | DUF900: Alpha/beta hydrolase of unknown function ( | 90.17 | |
| COG0400 | 207 | Predicted esterase [General function prediction on | 90.04 | |
| PLN03084 | 383 | alpha/beta hydrolase fold protein; Provisional | 89.97 | |
| PLN02442 | 283 | S-formylglutathione hydrolase | 89.74 | |
| PRK10566 | 249 | esterase; Provisional | 89.58 | |
| PLN02872 | 395 | triacylglycerol lipase | 89.57 | |
| TIGR03100 | 274 | hydr1_PEP hydrolase, ortholog 1, exosortase system | 89.55 | |
| TIGR01849 | 406 | PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, | 89.13 | |
| PF00151 | 331 | Lipase: Lipase; InterPro: IPR013818 Triglyceride l | 88.47 | |
| PF11187 | 224 | DUF2974: Protein of unknown function (DUF2974); In | 88.33 | |
| KOG2564 | 343 | consensus Predicted acetyltransferases and hydrola | 87.54 | |
| PLN00021 | 313 | chlorophyllase | 87.26 | |
| COG3243 | 445 | PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid me | 86.88 | |
| COG1647 | 243 | Esterase/lipase [General function prediction only] | 86.21 | |
| KOG2624 | 403 | consensus Triglyceride lipase-cholesterol esterase | 85.89 | |
| KOG2205 | 424 | consensus Uncharacterized conserved protein [Funct | 85.78 | |
| PRK05855 | 582 | short chain dehydrogenase; Validated | 85.55 | |
| PF00326 | 213 | Peptidase_S9: Prolyl oligopeptidase family This fa | 84.04 | |
| PF06821 | 171 | Ser_hydrolase: Serine hydrolase; InterPro: IPR0106 | 83.37 | |
| PLN02408 | 365 | phospholipase A1 | 82.4 | |
| TIGR03502 | 792 | lipase_Pla1_cef extracellular lipase, Pla-1/cef fa | 81.47 | |
| KOG4178 | 322 | consensus Soluble epoxide hydrolase [Lipid transpo | 81.39 | |
| PLN00413 | 479 | triacylglycerol lipase | 81.2 | |
| PF05277 | 345 | DUF726: Protein of unknown function (DUF726); Inte | 81.14 | |
| PLN02310 | 405 | triacylglycerol lipase | 81.05 | |
| PRK13604 | 307 | luxD acyl transferase; Provisional | 80.22 |
| >PLN02633 palmitoyl protein thioesterase family protein | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.9e-82 Score=585.33 Aligned_cols=214 Identities=64% Similarity=1.195 Sum_probs=207.2
Q ss_pred CccCCCcccEEEeChhhHHHHHHHHhcCCCCCcceEEEecCCCCCcccccCCC-ChhHHHHHHHhHhhhcccHHhhhccc
Q 025062 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG-SGIFCIIANNLIKAEVYSDYVQDHLA 79 (258)
Q Consensus 1 ~~~l~~GvnlIGhSQGGli~Rayiq~~~g~~kV~nlISLggPh~G~~~~P~c~-~~~lc~~~~~ll~~~~Y~~~vQ~~l~ 79 (258)
||+|++|||+|||||||+|+|||||+|+++|+|+|||||||||+|++++|.|+ ++++|++++++++.++|++++|++++
T Consensus 89 ~~~l~~G~naIGfSQGGlflRa~ierc~~~p~V~nlISlggph~Gv~g~p~C~~~~~~C~~~~~ll~~~~Ys~~vQ~~lv 168 (314)
T PLN02633 89 MKELSQGYNIVGRSQGNLVARGLIEFCDGGPPVYNYISLAGPHAGISSLPRCGTSGLICKIANELIKGDVYSDFIQDHLA 168 (314)
T ss_pred chhhhCcEEEEEEccchHHHHHHHHHCCCCCCcceEEEecCCCCCeeCCCCCCcchhhHHHHHHHHhhCCccHHHHhccc
Confidence 68999999999999999999999999997689999999999999999999996 78999999999999999999999999
Q ss_pred cCCccCCCCChhhhhhcCcchHHHHcCCCCCCchhHHHhhhccCCeEEEEeCCCcEeecCCcCcccccCCCCCcccccCc
Q 025062 80 PSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQ 159 (258)
Q Consensus 80 ~A~Y~rdP~~~~~yl~~S~FL~~LNne~~~~~n~~Yk~nf~~L~~~vli~~~~D~vV~P~eSs~Fg~y~~~~~~~vvpm~ 159 (258)
||||||||.+++.|+++|.|||+||||++...|.+||+||++|++||||+|++|+||+||||||||||++++.++|+||+
T Consensus 169 ~A~Yw~DP~~~d~Yl~~s~FLadINNEr~~~~n~tyK~Nf~~L~~~Vlv~f~~DtvV~PkeSswFg~Y~~~~~~~vvpl~ 248 (314)
T PLN02633 169 PSGYYKIPKDVTEYLKGSKYLPKLNNEIPDQRNQTYKDRFTSLQNLVLVKFQNDTVIVPKDSSWFGFYPDGEFEHLLSVQ 248 (314)
T ss_pred cccccCCchhHHHHHhcCcchhhhhCcCcccccHHHHHHHHhhhceEEEecCCCceECCCccccceeccCCCCceeechh
Confidence 99999999999999999999999999997778999999999999999999999999999999999999998878999999
Q ss_pred ccccccccccchHhHhhcCCeEEEeecCCcceecHHHHHHhhHhhhccccchhhh
Q 025062 160 KTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLKDQASVRVI 214 (258)
Q Consensus 160 et~~Y~eD~iGLktLde~G~l~f~~v~G~H~~~~~~~~~~~i~pyl~~~~~~~~~ 214 (258)
||++|+||||||||||++|||+|+++||+||+++++++.++|+|||.++.+++++
T Consensus 249 et~lY~eD~iGLktLD~~GkL~f~~v~G~Hl~~s~~~~~~~i~pyL~~~~~~~~~ 303 (314)
T PLN02633 249 QTKLYTEDWIGLKTLDDAGKVKFVSVPGGHLIMADEDVVKYVVPYLQDQQSAAQR 303 (314)
T ss_pred hcchhhhhhhhHHHHHHCCCeEEEecCCchhhcCHHHHHHHHHHHhhccchhHHH
Confidence 9999999999999999999999999999999999999999999999999887554
|
|
| >PLN02606 palmitoyl-protein thioesterase | Back alignment and domain information |
|---|
| >KOG2541 consensus Palmitoyl protein thioesterase [Lipid transport and metabolism; Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF02089 Palm_thioest: Palmitoyl protein thioesterase; InterPro: IPR002472 Neuronal ceroid lipofuscinoses (NCL) represent a group of encephalopathies that occur in 1 in 12,500 children | Back alignment and domain information |
|---|
| >PF01674 Lipase_2: Lipase (class 2); InterPro: IPR002918 Lipases or triacylglycerol acylhydrolases hydrolyse ester bonds in triacylglycerol giving diacylglycerol, monoacylglycerol, glycerol and free fatty acids [] | Back alignment and domain information |
|---|
| >PF05057 DUF676: Putative serine esterase (DUF676); InterPro: IPR007751 This domain, whose function is unknown, is found within a group of putative lipases | Back alignment and domain information |
|---|
| >PF07819 PGAP1: PGAP1-like protein; InterPro: IPR012908 The sequences found in this family are similar to PGAP1 (Q765A7 from SWISSPROT) | Back alignment and domain information |
|---|
| >COG1075 LipA Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF06028 DUF915: Alpha/beta hydrolase of unknown function (DUF915); InterPro: IPR010315 This family consists of bacterial proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >PF02450 LCAT: Lecithin:cholesterol acyltransferase; InterPro: IPR003386 Lecithin:cholesterol acyltransferase (LACT), also known as phosphatidylcholine-sterol acyltransferase (2 | Back alignment and domain information |
|---|
| >PLN02733 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >KOG3724 consensus Negative regulator of COPII vesicle formation [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >COG4814 Uncharacterized protein with an alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PF00561 Abhydrolase_1: alpha/beta hydrolase fold A web page of Esterases and alpha/beta hydrolases | Back alignment and domain information |
|---|
| >PF12697 Abhydrolase_6: Alpha/beta hydrolase family; PDB: 3LLC_A 3A2N_E 3A2M_A 3A2L_A 3AFI_F 3C5V_A 3C5W_P 3E0X_A 2ZJF_A 3QYJ_A | Back alignment and domain information |
|---|
| >PLN02965 Probable pheophorbidase | Back alignment and domain information |
|---|
| >cd00741 Lipase Lipase | Back alignment and domain information |
|---|
| >PLN02211 methyl indole-3-acetate methyltransferase | Back alignment and domain information |
|---|
| >PLN02824 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR01836 PHA_synth_III_C poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit | Back alignment and domain information |
|---|
| >PRK10985 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03343 biphenyl_bphD 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase | Back alignment and domain information |
|---|
| >PRK10349 carboxylesterase BioH; Provisional | Back alignment and domain information |
|---|
| >PLN02517 phosphatidylcholine-sterol O-acyltransferase | Back alignment and domain information |
|---|
| >PRK10749 lysophospholipase L2; Provisional | Back alignment and domain information |
|---|
| >PRK11126 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase; Provisional | Back alignment and domain information |
|---|
| >TIGR03056 bchO_mg_che_rel putative magnesium chelatase accessory protein | Back alignment and domain information |
|---|
| >PRK10673 acyl-CoA esterase; Provisional | Back alignment and domain information |
|---|
| >TIGR01250 pro_imino_pep_2 proline-specific peptidases, Bacillus coagulans-type subfamily | Back alignment and domain information |
|---|
| >PLN02578 hydrolase | Back alignment and domain information |
|---|
| >PLN03087 BODYGUARD 1 domain containing hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG4372 consensus Predicted alpha/beta hydrolase [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR01607 PST-A Plasmodium subtelomeric family (PST-A) | Back alignment and domain information |
|---|
| >PRK08775 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR02240 PHA_depoly_arom poly(3-hydroxyalkanoate) depolymerase | Back alignment and domain information |
|---|
| >TIGR03695 menH_SHCHC 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase | Back alignment and domain information |
|---|
| >PF12695 Abhydrolase_5: Alpha/beta hydrolase family; PDB: 3D0K_B 2I3D_B 3DOH_B 3DOI_B 3PFB_A 3S2Z_B 3PFC_A 3QM1_A 3PF8_B 3PF9_A | Back alignment and domain information |
|---|
| >PRK03592 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01738 bioH putative pimeloyl-BioC--CoA transferase BioH | Back alignment and domain information |
|---|
| >TIGR02427 protocat_pcaD 3-oxoadipate enol-lactonase | Back alignment and domain information |
|---|
| >PRK00870 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01392 homoserO_Ac_trn homoserine O-acetyltransferase | Back alignment and domain information |
|---|
| >PHA02857 monoglyceride lipase; Provisional | Back alignment and domain information |
|---|
| >PRK03204 haloalkane dehalogenase; Provisional | Back alignment and domain information |
|---|
| >PLN02298 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >COG2267 PldB Lysophospholipase [Lipid metabolism] | Back alignment and domain information |
|---|
| >KOG2369 consensus Lecithin:cholesterol acyltransferase (LCAT)/Acyl-ceramide synthase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >cd00707 Pancreat_lipase_like Pancreatic lipase-like enzymes | Back alignment and domain information |
|---|
| >TIGR03611 RutD pyrimidine utilization protein D | Back alignment and domain information |
|---|
| >COG0596 MhpC Predicted hydrolases or acyltransferases (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK06489 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF02230 Abhydrolase_2: Phospholipase/Carboxylesterase; InterPro: IPR003140 This entry represents the alpha/beta hydrolase domain found in phospholipases [], carboxylesterases [] and thioesterases | Back alignment and domain information |
|---|
| >PLN02511 hydrolase | Back alignment and domain information |
|---|
| >PLN02894 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PLN02385 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK07581 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR03230 lipo_lipase lipoprotein lipase | Back alignment and domain information |
|---|
| >PRK14875 acetoin dehydrogenase E2 subunit dihydrolipoyllysine-residue acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR01840 esterase_phb esterase, PHB depolymerase family | Back alignment and domain information |
|---|
| >PF01764 Lipase_3: Lipase (class 3); InterPro: IPR002921 Triglyceride lipases are lipolytic enzymes that hydrolyse ester linkages of triglycerides [] | Back alignment and domain information |
|---|
| >KOG4409 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PF11288 DUF3089: Protein of unknown function (DUF3089); InterPro: IPR021440 This family of proteins has no known function | Back alignment and domain information |
|---|
| >PRK00175 metX homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PRK07868 acyl-CoA synthetase; Validated | Back alignment and domain information |
|---|
| >TIGR01249 pro_imino_pep_1 proline iminopeptidase, Neisseria-type subfamily | Back alignment and domain information |
|---|
| >PRK06765 homoserine O-acetyltransferase; Provisional | Back alignment and domain information |
|---|
| >PLN02679 hydrolase, alpha/beta fold family protein | Back alignment and domain information |
|---|
| >TIGR03101 hydr2_PEP hydrolase, ortholog 2, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >PF01083 Cutinase: Cutinase; InterPro: IPR000675 Aerial plant organs are protected by a cuticle composed of an insoluble polymeric structural compound, cutin, which is a polyester composed of hydroxy and hydroxyepoxy fatty acids [] | Back alignment and domain information |
|---|
| >PRK11460 putative hydrolase; Provisional | Back alignment and domain information |
|---|
| >KOG2029 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >cd00519 Lipase_3 Lipase (class 3) | Back alignment and domain information |
|---|
| >PF00975 Thioesterase: Thioesterase domain; InterPro: IPR001031 Thioesterase domains often occur integrated in or associated with peptide synthetases which are involved in the non-ribosomal synthesis of peptide antibiotics [] | Back alignment and domain information |
|---|
| >PF06259 Abhydrolase_8: Alpha/beta hydrolase; InterPro: IPR010427 This is a family of uncharacterised proteins found in Actinobacteria | Back alignment and domain information |
|---|
| >PF03959 FSH1: Serine hydrolase (FSH1); InterPro: IPR005645 This entry represents proteins belonging to the AB hydrolase family | Back alignment and domain information |
|---|
| >TIGR01839 PHA_synth_II poly(R)-hydroxyalkanoic acid synthase, class II | Back alignment and domain information |
|---|
| >PF08237 PE-PPE: PE-PPE domain; InterPro: IPR013228 The human pathogen Mycobacterium tuberculosis harbours a large number of genes that encode proteins whose N-termini contain the characteristic motifs Pro-Glu (PE) or Pro-Pro-Glu (PPE) | Back alignment and domain information |
|---|
| >TIGR02821 fghA_ester_D S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >TIGR01838 PHA_synth_I poly(R)-hydroxyalkanoic acid synthase, class I | Back alignment and domain information |
|---|
| >KOG1454 consensus Predicted hydrolase/acyltransferase (alpha/beta hydrolase superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PLN02652 hydrolase; alpha/beta fold family protein | Back alignment and domain information |
|---|
| >PRK11071 esterase YqiA; Provisional | Back alignment and domain information |
|---|
| >PRK05077 frsA fermentation/respiration switch protein; Reviewed | Back alignment and domain information |
|---|
| >PLN02980 2-oxoglutarate decarboxylase/ hydro-lyase/ magnesium ion binding / thiamin pyrophosphate binding | Back alignment and domain information |
|---|
| >PF05990 DUF900: Alpha/beta hydrolase of unknown function (DUF900); InterPro: IPR010297 This domain is associated with proteins of unknown function, which are hydrolase-like | Back alignment and domain information |
|---|
| >COG0400 Predicted esterase [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03084 alpha/beta hydrolase fold protein; Provisional | Back alignment and domain information |
|---|
| >PLN02442 S-formylglutathione hydrolase | Back alignment and domain information |
|---|
| >PRK10566 esterase; Provisional | Back alignment and domain information |
|---|
| >PLN02872 triacylglycerol lipase | Back alignment and domain information |
|---|
| >TIGR03100 hydr1_PEP hydrolase, ortholog 1, exosortase system type 1 associated | Back alignment and domain information |
|---|
| >TIGR01849 PHB_depoly_PhaZ polyhydroxyalkanoate depolymerase, intracellular | Back alignment and domain information |
|---|
| >PF00151 Lipase: Lipase; InterPro: IPR013818 Triglyceride lipases (3 | Back alignment and domain information |
|---|
| >PF11187 DUF2974: Protein of unknown function (DUF2974); InterPro: IPR024499 This family of proteins has no known function | Back alignment and domain information |
|---|
| >KOG2564 consensus Predicted acetyltransferases and hydrolases with the alpha/beta hydrolase fold [General function prediction only] | Back alignment and domain information |
|---|
| >PLN00021 chlorophyllase | Back alignment and domain information |
|---|
| >COG3243 PhaC Poly(3-hydroxyalkanoate) synthetase [Lipid metabolism] | Back alignment and domain information |
|---|
| >COG1647 Esterase/lipase [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2624 consensus Triglyceride lipase-cholesterol esterase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >KOG2205 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK05855 short chain dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF00326 Peptidase_S9: Prolyl oligopeptidase family This family belongs to family S9 of the peptidase classification | Back alignment and domain information |
|---|
| >PF06821 Ser_hydrolase: Serine hydrolase; InterPro: IPR010662 This family contains a number of hypothetical bacterial proteins of unknown function, which may be cytosolic | Back alignment and domain information |
|---|
| >PLN02408 phospholipase A1 | Back alignment and domain information |
|---|
| >TIGR03502 lipase_Pla1_cef extracellular lipase, Pla-1/cef family | Back alignment and domain information |
|---|
| >KOG4178 consensus Soluble epoxide hydrolase [Lipid transport and metabolism] | Back alignment and domain information |
|---|
| >PLN00413 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PF05277 DUF726: Protein of unknown function (DUF726); InterPro: IPR007941 This family consists of several uncharacterised eukaryotic proteins | Back alignment and domain information |
|---|
| >PLN02310 triacylglycerol lipase | Back alignment and domain information |
|---|
| >PRK13604 luxD acyl transferase; Provisional | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 1eh5_A | 279 | Crystal Structure Of Palmitoyl Protein Thioesterase | 9e-31 | ||
| 3gro_A | 298 | Human Palmitoyl-Protein Thioesterase 1 Length = 298 | 1e-30 | ||
| 1pja_A | 302 | The Crystal Structure Of Palmitoyl Protein Thioeste | 6e-10 |
| >pdb|1EH5|A Chain A, Crystal Structure Of Palmitoyl Protein Thioesterase 1 Complexed With Palmitate Length = 279 | Back alignment and structure |
|
| >pdb|3GRO|A Chain A, Human Palmitoyl-Protein Thioesterase 1 Length = 298 | Back alignment and structure |
| >pdb|1PJA|A Chain A, The Crystal Structure Of Palmitoyl Protein Thioesterase-2 Reveals The Basis For Divergent Substrate Specificities Of The Two Lysosomal Thioesterases (Ppt1 And Ppt2) Length = 302 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 1e-84 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 7e-63 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 9e-09 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 4e-08 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 1e-04 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 1e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-04 |
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A Length = 279 | Back alignment and structure |
|---|
Score = 253 bits (647), Expect = 1e-84
Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 5/208 (2%)
Query: 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG--SGIFC 58
+L +GYN +G SQG R V + C PP+ N +S+GG H G +P C S C
Sbjct: 75 DPKLQQGYNAMGFSQGGQFLRAVAQRC-PSPPMVNLISVGGQHQGVFGLPRCPGESSHIC 133
Query: 59 IIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKEC 118
+ A Y+ +Q+ L + Y P Y FL +N E N +YK+
Sbjct: 134 DFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQERG--VNESYKKN 191
Query: 119 FSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAG 178
+L+ V++ F +D ++ P ++ WFG+Y G +P Q++ LYT+D +GLK +D AG
Sbjct: 192 LMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKAG 251
Query: 179 RVHFISVAGGHLKISKADMKKHIIPYLK 206
++ F+++ G HL++S+ HIIP+L+
Sbjct: 252 QLVFLALEGDHLQLSEEWFYAHIIPFLE 279
|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 Length = 302 | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A Length = 181 | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A Length = 342 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* Length = 316 | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* Length = 317 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 1ei9_A | 279 | Palmitoyl protein thioesterase 1; alpha/beta hydro | 100.0 | |
| 1pja_A | 302 | Palmitoyl-protein thioesterase 2 precursor; hydrol | 99.85 | |
| 3icv_A | 316 | Lipase B, CALB; circular permutation, cleavage on | 99.47 | |
| 2x5x_A | 342 | PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE | 99.35 | |
| 1tca_A | 317 | Lipase; hydrolase(carboxylic esterase); HET: NAG; | 98.82 | |
| 3fle_A | 249 | SE_1780 protein; structural genomics, APC61035.1, | 98.35 | |
| 3ds8_A | 254 | LIN2722 protein; unkonwn function, structural geno | 98.34 | |
| 3lp5_A | 250 | Putative cell surface hydrolase; structural genom | 98.29 | |
| 2dsn_A | 387 | Thermostable lipase; T1 lipase, hydrolase; 1.50A { | 98.27 | |
| 2hih_A | 431 | Lipase 46 kDa form; A1 phospholipase, phospholipid | 97.98 | |
| 1ex9_A | 285 | Lactonizing lipase; alpha-beta hydrolase fold, pho | 97.77 | |
| 1ys1_X | 320 | Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor h | 97.66 | |
| 1isp_A | 181 | Lipase; alpha/beta hydrolase fold, hydrolase; 1.30 | 97.37 | |
| 3r0v_A | 262 | Alpha/beta hydrolase fold protein; structural geno | 97.21 | |
| 1uxo_A | 192 | YDEN protein; hydrolase, A/B hydrolase, esterase, | 97.05 | |
| 2zyr_A | 484 | Lipase, putative; fatty acid, hydrolase; HET: 1PE; | 96.95 | |
| 1xkl_A | 273 | SABP2, salicylic acid-binding protein 2; alpha-bet | 96.93 | |
| 2xmz_A | 269 | Hydrolase, alpha/beta hydrolase fold family; menaq | 96.93 | |
| 1m33_A | 258 | BIOH protein; alpha-betta-alpha sandwich, structur | 96.92 | |
| 3c6x_A | 257 | Hydroxynitrilase; atomic resolution, hydroxynitril | 96.91 | |
| 2wfl_A | 264 | Polyneuridine-aldehyde esterase; alkaloid metaboli | 96.89 | |
| 3bdv_A | 191 | Uncharacterized protein DUF1234; DUF1234 family pr | 96.87 | |
| 1ehy_A | 294 | Protein (soluble epoxide hydrolase); alpha/beta hy | 96.75 | |
| 2cjp_A | 328 | Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tu | 96.75 | |
| 2ocg_A | 254 | Valacyclovir hydrolase; alpha beta hydrolase fold; | 96.74 | |
| 2xua_A | 266 | PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, cate | 96.69 | |
| 1tqh_A | 247 | Carboxylesterase precursor; tetrahedral intermedia | 96.68 | |
| 1q0r_A | 298 | RDMC, aclacinomycin methylesterase; anthracycline, | 96.66 | |
| 1hkh_A | 279 | Gamma lactamase; hydrolase, alpha/beta hydrolase, | 96.66 | |
| 1azw_A | 313 | Proline iminopeptidase; aminopeptidase, serine pro | 96.66 | |
| 2wue_A | 291 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolas | 96.66 | |
| 2puj_A | 286 | 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; | 96.65 | |
| 1wm1_A | 317 | Proline iminopeptidase; complex with inhibitor, hy | 96.63 | |
| 1mtz_A | 293 | Proline iminopeptidase; alpha-beta hydrolase, CAP | 96.62 | |
| 1iup_A | 282 | META-cleavage product hydrolase; aromatic compound | 96.61 | |
| 3v48_A | 268 | Aminohydrolase, putative aminoacrylate hydrolase R | 96.6 | |
| 3ibt_A | 264 | 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, | 96.58 | |
| 3om8_A | 266 | Probable hydrolase; structural genomics, PSI-2, pr | 96.58 | |
| 2qs9_A | 194 | Retinoblastoma-binding protein 9; B5T overexpresse | 96.56 | |
| 3sty_A | 267 | Methylketone synthase 1; alpha/beta hydrolase, dec | 96.53 | |
| 3kda_A | 301 | CFTR inhibitory factor (CIF); alpha/beta hydrolase | 96.53 | |
| 3u1t_A | 309 | DMMA haloalkane dehalogenase; alpha/beta-hydrolase | 96.52 | |
| 4dnp_A | 269 | DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petu | 96.51 | |
| 2wtm_A | 251 | EST1E; hydrolase; 1.60A {Clostridium proteoclastic | 96.51 | |
| 1u2e_A | 289 | 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase | 96.5 | |
| 3r40_A | 306 | Fluoroacetate dehalogenase; FACD, defluorinase, al | 96.49 | |
| 3dqz_A | 258 | Alpha-hydroxynitrIle lyase-like protein; A/B-hydrl | 96.49 | |
| 1zoi_A | 276 | Esterase; alpha/beta hydrolase fold; 1.60A {Pseudo | 96.48 | |
| 1c4x_A | 285 | BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-di | 96.48 | |
| 3bf7_A | 255 | Esterase YBFF; thioesterase, helical CAP, hydrolas | 96.46 | |
| 3l80_A | 292 | Putative uncharacterized protein SMU.1393C; alpha/ | 96.45 | |
| 1wom_A | 271 | RSBQ, sigma factor SIGB regulation protein RSBQ; a | 96.42 | |
| 3i1i_A | 377 | Homoserine O-acetyltransferase; structural genomic | 96.41 | |
| 3qit_A | 286 | CURM TE, polyketide synthase; thioesterase, alpha/ | 96.4 | |
| 2psd_A | 318 | Renilla-luciferin 2-monooxygenase; alpha/beta-hydr | 96.38 | |
| 3nwo_A | 330 | PIP, proline iminopeptidase; structural genomics, | 96.37 | |
| 1a8q_A | 274 | Bromoperoxidase A1; haloperoxidase, oxidoreductase | 96.36 | |
| 3qvm_A | 282 | OLEI00960; structural genomics, PSI-biology, midwe | 96.32 | |
| 3bwx_A | 285 | Alpha/beta hydrolase; YP_496220.1, joint center fo | 96.32 | |
| 3oos_A | 278 | Alpha/beta hydrolase family protein; APC67239.0, p | 96.32 | |
| 2yys_A | 286 | Proline iminopeptidase-related protein; TTHA1809, | 96.31 | |
| 1j1i_A | 296 | META cleavage compound hydrolase; carbazole degrad | 96.31 | |
| 3pe6_A | 303 | Monoglyceride lipase; alpha-beta hydrolase fold, 2 | 96.29 | |
| 1a88_A | 275 | Chloroperoxidase L; haloperoxidase, oxidoreductase | 96.26 | |
| 1auo_A | 218 | Carboxylesterase; hydrolase; 1.80A {Pseudomonas fl | 96.25 | |
| 4fbl_A | 281 | LIPS lipolytic enzyme; thermostable, structural ge | 96.25 | |
| 1brt_A | 277 | Bromoperoxidase A2; haloperoxidase, oxidoreductase | 96.22 | |
| 1r3d_A | 264 | Conserved hypothetical protein VC1974; structural | 96.22 | |
| 3fsg_A | 272 | Alpha/beta superfamily hydrolase; PF00561, MCSG, P | 96.21 | |
| 3e0x_A | 245 | Lipase-esterase related protein; APC60309, clostri | 96.19 | |
| 2pl5_A | 366 | Homoserine O-acetyltransferase; alpha/beta hydrola | 96.18 | |
| 3hju_A | 342 | Monoglyceride lipase; alpha/beta hydrolase, hydrol | 96.16 | |
| 3p2m_A | 330 | Possible hydrolase; alpha/beta hydrolase superfami | 96.14 | |
| 3afi_E | 316 | Haloalkane dehalogenase; A/B-hydrolase, hydrolase; | 96.13 | |
| 3ksr_A | 290 | Putative serine hydrolase; catalytic triad, struct | 96.13 | |
| 3h04_A | 275 | Uncharacterized protein; protein with unknown func | 96.12 | |
| 1a8s_A | 273 | Chloroperoxidase F; haloperoxidase, oxidoreductase | 96.1 | |
| 3g9x_A | 299 | Haloalkane dehalogenase; alpha/beta hydrolase, hel | 96.1 | |
| 3c5v_A | 316 | PME-1, protein phosphatase methylesterase 1; demet | 96.1 | |
| 3qyj_A | 291 | ALR0039 protein; alpha/beta fold, hydrolase; 1.78A | 96.09 | |
| 2xt0_A | 297 | Haloalkane dehalogenase; hydrolase, alpha-beta hyd | 96.09 | |
| 3hss_A | 293 | Putative bromoperoxidase; alpha beta hydrolase, ox | 96.08 | |
| 2qmq_A | 286 | Protein NDRG2, protein NDR2; alpha/beta-hydrolases | 96.06 | |
| 2h1i_A | 226 | Carboxylesterase; structural genomics, PSI-2, prot | 96.05 | |
| 2qvb_A | 297 | Haloalkane dehalogenase 3; RV2579, alpha-beta hydr | 96.04 | |
| 3llc_A | 270 | Putative hydrolase; structural genomics, joint cen | 96.01 | |
| 2wj6_A | 276 | 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxid | 95.99 | |
| 2qjw_A | 176 | Uncharacterized protein XCC1541; putative hydrolas | 95.98 | |
| 1fj2_A | 232 | Protein (acyl protein thioesterase 1); alpha/beta | 95.93 | |
| 4g9e_A | 279 | AHL-lactonase, alpha/beta hydrolase fold protein; | 95.92 | |
| 3b5e_A | 223 | MLL8374 protein; NP_108484.1, carboxylesterase, st | 95.91 | |
| 3bdi_A | 207 | Uncharacterized protein TA0194; NP_393672.1, predi | 95.9 | |
| 3rm3_A | 270 | MGLP, thermostable monoacylglycerol lipase; alpha/ | 95.88 | |
| 1mj5_A | 302 | 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; | 95.88 | |
| 3og9_A | 209 | Protein YAHD A copper inducible hydrolase; alpha/b | 95.86 | |
| 2vat_A | 444 | Acetyl-COA--deacetylcephalosporin C acetyltransfer | 95.85 | |
| 4f0j_A | 315 | Probable hydrolytic enzyme; alpha/beta hydrolase f | 95.83 | |
| 2b61_A | 377 | Homoserine O-acetyltransferase; acyl-enzyme, aspar | 95.82 | |
| 3ia2_A | 271 | Arylesterase; alpha-beta hydrolase fold, transitio | 95.82 | |
| 1imj_A | 210 | CIB, CCG1-interacting factor B; alpha/beta hydrola | 95.82 | |
| 1tgl_A | 269 | Triacyl-glycerol acylhydrolase; carboxylic esteras | 95.75 | |
| 3fla_A | 267 | RIFR; alpha-beta hydrolase thioesterase, hydrolase | 95.74 | |
| 1dqz_A | 280 | 85C, protein (antigen 85-C); fibronectin, structur | 95.72 | |
| 3u0v_A | 239 | Lysophospholipase-like protein 1; alpha, beta hydr | 95.71 | |
| 3pfb_A | 270 | Cinnamoyl esterase; alpha/beta hydrolase fold, hyd | 95.68 | |
| 2y6u_A | 398 | Peroxisomal membrane protein LPX1; hydrolase, puta | 95.64 | |
| 2o2g_A | 223 | Dienelactone hydrolase; YP_324580.1, structural ge | 95.63 | |
| 3b12_A | 304 | Fluoroacetate dehalogenase; dehalogease, hydrolase | 94.61 | |
| 3cn9_A | 226 | Carboxylesterase; alpha/beta hydrolase fold super- | 95.61 | |
| 3fob_A | 281 | Bromoperoxidase; structural genomics, IDP00046, ba | 95.6 | |
| 3ils_A | 265 | PKS, aflatoxin biosynthesis polyketide synthase; A | 95.59 | |
| 2e3j_A | 356 | Epoxide hydrolase EPHB; epoxide hydrolase B, struc | 95.58 | |
| 2r11_A | 306 | Carboxylesterase NP; 2632844, putative hydrolase, | 95.58 | |
| 2q0x_A | 335 | Protein DUF1749, uncharacterized protein; alpha/be | 95.57 | |
| 3i28_A | 555 | Epoxide hydrolase 2; aromatic hydrocarbons catabol | 95.55 | |
| 1b6g_A | 310 | Haloalkane dehalogenase; hydrolase, alpha/beta-hyd | 95.53 | |
| 3trd_A | 208 | Alpha/beta hydrolase; cellular processes; 1.50A {C | 95.51 | |
| 2fuk_A | 220 | XC6422 protein; A/B hydrolase, structural genomics | 95.47 | |
| 1w52_X | 452 | Pancreatic lipase related protein 2; detergent, cl | 95.47 | |
| 1k8q_A | 377 | Triacylglycerol lipase, gastric; APHA beta hydrola | 95.41 | |
| 2r8b_A | 251 | AGR_C_4453P, uncharacterized protein ATU2452; APC6 | 95.33 | |
| 1bu8_A | 452 | Protein (pancreatic lipase related protein 2); hyd | 95.32 | |
| 3lcr_A | 319 | Tautomycetin biosynthetic PKS; alpha-beta hydrolas | 95.32 | |
| 1tib_A | 269 | Lipase; hydrolase(carboxylic esterase); 1.84A {The | 95.28 | |
| 3dkr_A | 251 | Esterase D; alpha beta hydrolase, mechanism, catal | 95.22 | |
| 3kxp_A | 314 | Alpha-(N-acetylaminomethylene)succinic acid hydrol | 95.18 | |
| 1tht_A | 305 | Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1. | 95.18 | |
| 3tej_A | 329 | Enterobactin synthase component F; nonribosomal pe | 95.07 | |
| 2rau_A | 354 | Putative esterase; NP_343859.1, putative lipase, s | 95.04 | |
| 1gpl_A | 432 | RP2 lipase; serine esterase, hydrolase, lipid degr | 95.04 | |
| 1kez_A | 300 | Erythronolide synthase; polyketide synthase, modul | 94.97 | |
| 1lgy_A | 269 | Lipase, triacylglycerol lipase; hydrolase (carboxy | 94.85 | |
| 3tjm_A | 283 | Fatty acid synthase; thioesterase domain, fatty ac | 94.85 | |
| 1sfr_A | 304 | Antigen 85-A; alpha/beta hydrolase, structural gen | 94.82 | |
| 3e4d_A | 278 | Esterase D; S-formylglutathione hydrolase, hydrola | 94.82 | |
| 2i3d_A | 249 | AGR_C_3351P, hypothetical protein ATU1826; structu | 94.8 | |
| 1hpl_A | 449 | Lipase; hydrolase(carboxylic esterase); 2.30A {Equ | 94.8 | |
| 3i6y_A | 280 | Esterase APC40077; lipase, structural genomics, PS | 94.8 | |
| 1ufo_A | 238 | Hypothetical protein TT1662; alpha-beta fold, hydr | 94.74 | |
| 3fcx_A | 282 | FGH, esterase D, S-formylglutathione hydrolase; re | 94.67 | |
| 1jfr_A | 262 | Lipase; serine hydrolase; 1.90A {Streptomyces exfo | 94.59 | |
| 1r88_A | 280 | MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBP | 94.56 | |
| 2uz0_A | 263 | Esterase, tributyrin esterase; alpha/beta hydrolas | 94.54 | |
| 3d0k_A | 304 | Putative poly(3-hydroxybutyrate) depolymerase LPQ; | 94.52 | |
| 2pbl_A | 262 | Putative esterase/lipase/thioesterase; alpha/beta- | 94.48 | |
| 1jmk_C | 230 | SRFTE, surfactin synthetase; thioesterase, non-rib | 94.44 | |
| 4b6g_A | 283 | Putative esterase; hydrolase, formaldehyde detoxif | 94.42 | |
| 3ls2_A | 280 | S-formylglutathione hydrolase; psychrophilic organ | 94.4 | |
| 1rp1_A | 450 | Pancreatic lipase related protein 1; hydrolase, li | 94.37 | |
| 3n2z_B | 446 | Lysosomal Pro-X carboxypeptidase; alpha/beta hydro | 94.31 | |
| 2cb9_A | 244 | Fengycin synthetase; thioesterase, non-ribosomal p | 94.16 | |
| 1vkh_A | 273 | Putative serine hydrolase; structural genomics, jo | 94.16 | |
| 3d7r_A | 326 | Esterase; alpha/beta fold, hydrolase; 2.01A {Staph | 94.1 | |
| 3bxp_A | 277 | Putative lipase/esterase; putative carboxylesteras | 94.08 | |
| 3qmv_A | 280 | Thioesterase, REDJ; alpha/beta hydrolase fold, hyd | 93.95 | |
| 4h0c_A | 210 | Phospholipase/carboxylesterase; PSI-biology, midwe | 93.93 | |
| 4i19_A | 388 | Epoxide hydrolase; structural genomics, PSI-biolog | 93.92 | |
| 2hfk_A | 319 | Pikromycin, type I polyketide synthase pikaiv; alp | 93.67 | |
| 1qlw_A | 328 | Esterase; anisotropic refinement, atomic resolutio | 93.54 | |
| 3k2i_A | 422 | Acyl-coenzyme A thioesterase 4; alpha/beta hydrola | 93.54 | |
| 1jjf_A | 268 | Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-x | 93.37 | |
| 3bjr_A | 283 | Putative carboxylesterase; structural genomics, jo | 93.25 | |
| 1zi8_A | 236 | Carboxymethylenebutenolidase; alpha and beta prote | 93.19 | |
| 4f21_A | 246 | Carboxylesterase/phospholipase family protein; str | 92.96 | |
| 1tia_A | 279 | Lipase; hydrolase(carboxylic esterase); 2.10A {Pen | 92.9 | |
| 4fle_A | 202 | Esterase; structural genomics, PSI-biology, northe | 92.88 | |
| 3qpa_A | 197 | Cutinase; alpha-beta hydrolase fold, esterase, hyd | 92.88 | |
| 3hlk_A | 446 | Acyl-coenzyme A thioesterase 2, mitochondrial; alp | 92.82 | |
| 2dst_A | 131 | Hypothetical protein TTHA1544; conserved hypotheti | 92.63 | |
| 1ycd_A | 243 | Hypothetical 27.3 kDa protein in AAP1-SMF2 interge | 92.54 | |
| 2k2q_B | 242 | Surfactin synthetase thioesterase subunit; A/B-hyd | 92.51 | |
| 3vis_A | 306 | Esterase; alpha/beta-hydrolase fold, polyethylene | 92.47 | |
| 2hm7_A | 310 | Carboxylesterase; alpha/beta hydrolase fold, hydro | 92.43 | |
| 3doh_A | 380 | Esterase; alpha-beta hydrolase, beta sheet; 2.60A | 92.42 | |
| 3fcy_A | 346 | Xylan esterase 1; alpha/beta hydrolase, carbohydra | 92.4 | |
| 2zsh_A | 351 | Probable gibberellin receptor GID1L1; plant hormon | 92.35 | |
| 4fhz_A | 285 | Phospholipase/carboxylesterase; alpha/beta hydrola | 92.06 | |
| 3vdx_A | 456 | Designed 16NM tetrahedral protein CAGE containing | 92.04 | |
| 3f67_A | 241 | Putative dienelactone hydrolase; alpha-beta-alpha | 92.01 | |
| 4e15_A | 303 | Kynurenine formamidase; alpha/beta hydrolase fold, | 91.9 | |
| 3hxk_A | 276 | Sugar hydrolase; alpha-beta protein., structural g | 91.88 | |
| 3mve_A | 415 | FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/ | 91.7 | |
| 2fx5_A | 258 | Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pse | 91.69 | |
| 2hdw_A | 367 | Hypothetical protein PA2218; alpha/beta hydrolase | 91.51 | |
| 2c7b_A | 311 | Carboxylesterase, ESTE1; carboxyesterase, thermoph | 91.5 | |
| 1uwc_A | 261 | Feruloyl esterase A; hydrolase, serine esterase, x | 91.37 | |
| 2px6_A | 316 | Thioesterase domain; thioesaterse domain, orlistat | 91.35 | |
| 2o7r_A | 338 | CXE carboxylesterase; alpha/beta hydrolase; 1.40A | 91.31 | |
| 1l7a_A | 318 | Cephalosporin C deacetylase; structural genomics, | 91.28 | |
| 3o0d_A | 301 | YALI0A20350P, triacylglycerol lipase; alpha/beta-h | 91.27 | |
| 3qpd_A | 187 | Cutinase 1; alpha-beta hydrolase fold, esterase, h | 91.26 | |
| 3fnb_A | 405 | Acylaminoacyl peptidase SMU_737; alpha-beta-alpha | 90.88 | |
| 2jbw_A | 386 | Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine | 90.58 | |
| 1jji_A | 311 | Carboxylesterase; alpha-beta hydrolase fold, hydro | 90.49 | |
| 1gkl_A | 297 | Endo-1,4-beta-xylanase Y; hydrolase, esterase fami | 90.39 | |
| 3ngm_A | 319 | Extracellular lipase; secret lipase, hydrolase; 2. | 90.28 | |
| 1vlq_A | 337 | Acetyl xylan esterase; TM0077, structural genomics | 90.05 | |
| 3dcn_A | 201 | Cutinase, cutin hydrolase; catalytic triad, secret | 90.05 | |
| 2czq_A | 205 | Cutinase-like protein; alpha/beta hydrolase fold, | 89.96 | |
| 1lzl_A | 323 | Heroin esterase; alpha/beta hydrolase; 1.30A {Rhod | 89.86 | |
| 2wir_A | 313 | Pesta, alpha/beta hydrolase fold-3 domain protein; | 89.84 | |
| 2z3z_A | 706 | Dipeptidyl aminopeptidase IV; peptidase family S9, | 89.51 | |
| 3hc7_A | 254 | Gene 12 protein, GP12; alpha/beta sandwich, cell a | 89.43 | |
| 3c8d_A | 403 | Enterochelin esterase; alpha-beta-alpha sandwich, | 89.08 | |
| 3k6k_A | 322 | Esterase/lipase; alpha/beta hydrolase fold; 2.20A | 89.05 | |
| 3o4h_A | 582 | Acylamino-acid-releasing enzyme; alpha/beta hydrol | 88.94 | |
| 2qm0_A | 275 | BES; alpha-beta structure, structural genomics, PS | 88.86 | |
| 2ecf_A | 741 | Dipeptidyl peptidase IV; prolyl oligopeptidase fam | 88.7 | |
| 1qoz_A | 207 | AXE, acetyl xylan esterase; hydrolase, xylan degra | 88.62 | |
| 3fak_A | 322 | Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Unc | 88.56 | |
| 1g66_A | 207 | Acetyl xylan esterase II; serine hydrolase, acetyl | 88.37 | |
| 3aja_A | 302 | Putative uncharacterized protein; alpha-beta hydro | 87.96 | |
| 1z68_A | 719 | Fibroblast activation protein, alpha subunit; sepr | 87.96 | |
| 3d59_A | 383 | Platelet-activating factor acetylhydrolase; secret | 87.71 | |
| 1jkm_A | 361 | Brefeldin A esterase; serine hydrolase, degradatio | 87.51 | |
| 3g02_A | 408 | Epoxide hydrolase; alpha/beta hydrolase fold, enan | 87.28 | |
| 2qru_A | 274 | Uncharacterized protein; alpha/beta-hydrolase, str | 86.63 | |
| 3uue_A | 279 | LIP1, secretory lipase (family 3); LID-domain, hyd | 86.55 | |
| 3azo_A | 662 | Aminopeptidase; POP family, hydrolase; 2.00A {Stre | 86.51 | |
| 3ain_A | 323 | 303AA long hypothetical esterase; carboxylesterase | 86.41 | |
| 3g7n_A | 258 | Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A | 86.06 | |
| 3h2g_A | 397 | Esterase; xanthomonas oryzae PV. oryzae, cell WALL | 85.2 | |
| 4ezi_A | 377 | Uncharacterized protein; alpha-beta hydrolases fol | 85.17 | |
| 3qh4_A | 317 | Esterase LIPW; structural genomics, ssgcid, seattl | 85.1 | |
| 2xdw_A | 710 | Prolyl endopeptidase; alpha/beta-hydrolase, amnesi | 85.05 | |
| 2gzs_A | 278 | IROE protein; enterobactin, salmochelin, DFP, hydr | 85.02 | |
| 4a5s_A | 740 | Dipeptidyl peptidase 4 soluble form; hydrolase, ty | 84.76 | |
| 1xfd_A | 723 | DIP, dipeptidyl aminopeptidase-like protein 6, dip | 84.4 | |
| 2bkl_A | 695 | Prolyl endopeptidase; mechanistic study, celiac sp | 84.29 | |
| 3gff_A | 331 | IROE-like serine hydrolase; NP_718593.1, structura | 83.91 | |
| 1yr2_A | 741 | Prolyl oligopeptidase; prolyl endopeptidase, mecha | 83.78 | |
| 3ga7_A | 326 | Acetyl esterase; phosphoserine, IDP00896, hydrolas | 83.64 | |
| 3ebl_A | 365 | Gibberellin receptor GID1; alpha/beta hydrolase, l | 82.94 | |
| 3iuj_A | 693 | Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas | 81.77 | |
| 3g8y_A | 391 | SUSD/RAGB-associated esterase-like protein; struct | 80.98 | |
| 2ory_A | 346 | Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Ph | 80.55 |
| >1ei9_A Palmitoyl protein thioesterase 1; alpha/beta hydrolase, glycoprotein, hydrolase; HET: NDG NAG; 2.25A {Bos taurus} SCOP: c.69.1.13 PDB: 1eh5_A* 1exw_A* 3gro_A | Back alignment and structure |
|---|
Probab=100.00 E-value=4.4e-48 Score=347.18 Aligned_cols=200 Identities=35% Similarity=0.698 Sum_probs=188.7
Q ss_pred CCCcccEEEeChhhHHHHHHHHhcCCCCCcceEEEecCCCCCcccccCCC--ChhHHHHHHHhHhhhcccHHhhhccccC
Q 025062 4 LSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG--SGIFCIIANNLIKAEVYSDYVQDHLAPS 81 (258)
Q Consensus 4 l~~GvnlIGhSQGGli~Rayiq~~~g~~kV~nlISLggPh~G~~~~P~c~--~~~lc~~~~~ll~~~~Y~~~vQ~~l~~A 81 (258)
+++++++|||||||+|+|+|+++|++ ++|++||++|+||+|+...|.|. ...+|..+..+++...|++++|+.++++
T Consensus 78 l~~~~~lvGhSmGG~ia~~~a~~~~~-~~v~~lv~~~~p~~g~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~ 156 (279)
T 1ei9_A 78 LQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERLVQA 156 (279)
T ss_dssp GTTCEEEEEETTHHHHHHHHHHHCCS-SCEEEEEEESCCTTCBCSCTTCCSTTCHHHHHHHHHTHHHHTSHHHHHHCTGG
T ss_pred ccCCEEEEEECHHHHHHHHHHHHcCC-cccceEEEecCccCCccCCCCCccccchHHHHHHHHhcccccChHHhcccccc
Confidence 55789999999999999999999985 57999999999999999999996 3567988888888888999999999999
Q ss_pred CccCCCCChhhhhhcCcchHHHHcCCCCCCchhHHHhhhccCCeEEEEeCCCcEeecCCcCcccccCCCCCcccccCccc
Q 025062 82 GYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKT 161 (258)
Q Consensus 82 ~Y~rdP~~~~~yl~~S~FL~~LNne~~~~~n~~Yk~nf~~L~~~vli~~~~D~vV~P~eSs~Fg~y~~~~~~~vvpm~et 161 (258)
+||+||...++|+.+|.||++||++.. .+.+|++|+.+|+++++|.+++|++|+|++|+||++|.+++++.|+||++|
T Consensus 157 ~~~~d~~~~~~~~~~s~fl~~ln~~~~--~~~~~~~~l~~l~~~~li~g~~D~~v~p~~s~~~~~~~~~~~~~~~~~~~~ 234 (279)
T 1ei9_A 157 EYWHDPIREDIYRNHSIFLADINQERG--VNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQES 234 (279)
T ss_dssp GGBCCSTTHHHHHHHCSSHHHHTTTTS--CCHHHHHHHHTSSEEEEEEETTCSSSSSGGGGGTCEECTTCSSCEECGGGS
T ss_pred ccccCchhHHHHHhcCcchhhhhhhhh--hhHHHHHHHHhhCccEEEecCCCceECCCccceeeEecCCCCceEechhhc
Confidence 999999999999999999999999973 678999999999999999999999999999999999998889999999999
Q ss_pred ccccccccchHhHhhcCCeEEEeecCCcceecHHHHHHhhHhhhc
Q 025062 162 KLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK 206 (258)
Q Consensus 162 ~~Y~eD~iGLktLde~G~l~f~~v~G~H~~~~~~~~~~~i~pyl~ 206 (258)
.+|+|||+|||+||++|+++|++|||.||.+++++|.++|+|||.
T Consensus 235 ~~y~ed~~gl~~l~~~~~~~~~~v~g~H~~~~~~~~~~~i~~~l~ 279 (279)
T 1ei9_A 235 TLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAHIIPFLE 279 (279)
T ss_dssp HHHHTTSSSHHHHHHTTCEEEEEESSSTTCCCHHHHHHHTGGGTC
T ss_pred chhHhhhhhHHHHHHCCCeEEEeccCchhccCHHHHHHHHHHhcC
Confidence 999999999999999999999999999999999999999999984
|
| >1pja_A Palmitoyl-protein thioesterase 2 precursor; hydrolase, glycoprotein, lysosome; HET: NAG; 2.70A {Homo sapiens} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3icv_A Lipase B, CALB; circular permutation, cleavage on PAIR of basic residues, glycoprotein, hydrolase, lipid degradation, zymogen, disulf; HET: NAG BTB; 1.49A {Candida antarctica} PDB: 3icw_A* | Back alignment and structure |
|---|
| >2x5x_A PHB depolymerase PHAZ7; biopolymers, oxyanion HOLE, hydrolase, biodegradation, catal; HET: PG4; 1.20A {Paucimonas lemoignei} PDB: 2vtv_A* 2x76_A | Back alignment and structure |
|---|
| >1tca_A Lipase; hydrolase(carboxylic esterase); HET: NAG; 1.55A {Candida antarctica} SCOP: c.69.1.17 PDB: 1lbs_A* 1lbt_A* 1tcb_A* 1tcc_A* | Back alignment and structure |
|---|
| >3fle_A SE_1780 protein; structural genomics, APC61035.1, PSI-2, protein structure in midwest center for structural genomics, MCSG; 2.01A {Staphylococcus epidermidis} | Back alignment and structure |
|---|
| >3ds8_A LIN2722 protein; unkonwn function, structural genomics, PSI, MCSG, P structure initiative; 1.80A {Listeria innocua} | Back alignment and structure |
|---|
| >3lp5_A Putative cell surface hydrolase; structural genom PSI2, MCSG, protein structure initiative, midwest center FO structural genomics; 2.00A {Lactobacillus plantarum} | Back alignment and structure |
|---|
| >2dsn_A Thermostable lipase; T1 lipase, hydrolase; 1.50A {Geobacillus zalihae} PDB: 3umj_A 2z5g_A 1ji3_A 3auk_A 2w22_A* 1ku0_A | Back alignment and structure |
|---|
| >2hih_A Lipase 46 kDa form; A1 phospholipase, phospholipid binding, hydrolase; 2.86A {Staphylococcus hyicus} | Back alignment and structure |
|---|
| >1ex9_A Lactonizing lipase; alpha-beta hydrolase fold, phosphonate inhibitor; HET: OCP; 2.54A {Pseudomonas aeruginosa} SCOP: c.69.1.18 | Back alignment and structure |
|---|
| >1ys1_X Lipase; CIS peptide Leu 234, Ca2+ ION, inhibitor hexylphosphonic acid (R) 2-methyl-3-phenylpropyl ester, hydrolase; HET: 2HR; 1.10A {Burkholderia cepacia} PDB: 1ys2_X* 4lip_D 1hqd_A 2lip_A 1oil_A* 3lip_A 2nw6_A 5lip_A* 1cvl_A 2es4_A 1tah_B 1qge_D 1qge_E | Back alignment and structure |
|---|
| >1isp_A Lipase; alpha/beta hydrolase fold, hydrolase; 1.30A {Bacillus subtilis} SCOP: c.69.1.18 PDB: 1i6w_A 1r4z_A* 1r50_A* 2qxu_A 2qxt_A 1t4m_A 1t2n_A 3d2a_A 3qzu_A 3d2b_A 3d2c_A 3qmm_A | Back alignment and structure |
|---|
| >3r0v_A Alpha/beta hydrolase fold protein; structural genomics, PSI-biology, protein structure initiati alpha/beta hydrolase; HET: MSE; 1.38A {Sphaerobacter thermophilus} | Back alignment and structure |
|---|
| >1uxo_A YDEN protein; hydrolase, A/B hydrolase, esterase, PSI, protein structure initiative, MCSG, midwest center for structural genomics; 1.8A {Bacillus subtilis} SCOP: c.69.1.31 | Back alignment and structure |
|---|
| >2zyr_A Lipase, putative; fatty acid, hydrolase; HET: 1PE; 1.77A {Archaeoglobus fulgidus} PDB: 2zys_A* 2zyi_A* 2zyh_A* | Back alignment and structure |
|---|
| >1xkl_A SABP2, salicylic acid-binding protein 2; alpha-beta protein, structural genomics, protein structure initiative, PSI; HET: STH; 2.00A {Nicotiana tabacum} SCOP: c.69.1.20 PDB: 1y7i_A* 1y7h_A* | Back alignment and structure |
|---|
| >2xmz_A Hydrolase, alpha/beta hydrolase fold family; menaquinone biosynthesis, lyase; 1.94A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1m33_A BIOH protein; alpha-betta-alpha sandwich, structural genomics, PSI, protei structure initiative; HET: MSE 3OH; 1.70A {Escherichia coli} SCOP: c.69.1.26 | Back alignment and structure |
|---|
| >3c6x_A Hydroxynitrilase; atomic resolution, hydroxynitril lyase, catalysis, protonation state, AB initio calculations, substrate bindin; 1.05A {Hevea brasiliensis} SCOP: c.69.1.20 PDB: 1sc9_A 1yas_A* 2g4l_A* 2yas_A 1qj4_A 3c6y_A 3c6z_A 3c70_A 3yas_A 4yas_A 5yas_A* 6yas_A 7yas_A* 1yb6_A* 1yb7_A 1sck_A 1sci_A 1scq_A 1dwo_A 1dwp_A ... | Back alignment and structure |
|---|
| >2wfl_A Polyneuridine-aldehyde esterase; alkaloid metabolism, monoterpenoid indole alkaloids, PNAE, hydrolase, serine esterase; HET: CME; 2.10A {Rauvolfia serpentina} PDB: 2wfm_A 3gzj_A* | Back alignment and structure |
|---|
| >3bdv_A Uncharacterized protein DUF1234; DUF1234 family protein, alpha/beta-hydrolases fold, structur genomics; HET: MSE; 1.66A {Pectobacterium atrosepticum SCRI1043} | Back alignment and structure |
|---|
| >1ehy_A Protein (soluble epoxide hydrolase); alpha/beta hydrolase fold, epoxide degradation, epichlorohydrin; 2.10A {Agrobacterium tumefaciens} SCOP: c.69.1.11 | Back alignment and structure |
|---|
| >2cjp_A Epoxide hydrolase; HET: PG4 VPR; 1.95A {Solanum tuberosum} PDB: 3cxu_A* | Back alignment and structure |
|---|
| >2ocg_A Valacyclovir hydrolase; alpha beta hydrolase fold; 1.75A {Homo sapiens} PDB: 2oci_A* 2ock_A 2ocl_A | Back alignment and structure |
|---|
| >2xua_A PCAD, 3-oxoadipate ENOL-lactonase; hydrolase, catechol metabolism; 1.90A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >1tqh_A Carboxylesterase precursor; tetrahedral intermediate, alpha/beta hydrolase; 1.63A {Geobacillus stearothermophilus} SCOP: c.69.1.29 PDB: 1r1d_A* 4diu_A | Back alignment and structure |
|---|
| >1q0r_A RDMC, aclacinomycin methylesterase; anthracycline, hydrolase, polyketide, tailoring enzyme, structural proteomics in europe, spine; HET: AKT 1PE; 1.45A {Streptomyces purpurascens} SCOP: c.69.1.28 PDB: 1q0z_A* | Back alignment and structure |
|---|
| >1hkh_A Gamma lactamase; hydrolase, alpha/beta hydrolase, CO-factor free haloperoxidase,; 1.73A {Microbacterium} SCOP: c.69.1.12 PDB: 1hl7_A* | Back alignment and structure |
|---|
| >1azw_A Proline iminopeptidase; aminopeptidase, serine protease, xanthomonas campestris; 2.70A {Xanthomonas citri} SCOP: c.69.1.7 | Back alignment and structure |
|---|
| >2wue_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrolase BPHD; HET: KEK; 1.80A {Mycobacterium tuberculosis} PDB: 2wud_A* 2wuf_A* 2wug_A* 2vf2_A | Back alignment and structure |
|---|
| >2puj_A 2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoate hydrola; C-C bond hydrolase, hydrolase; HET: HPZ; 1.57A {Burkholderia xenovorans} PDB: 2pu7_A* 3v1m_A* 3v1l_A* 2puh_A* 3v1n_A* 3v1k_A* 2og1_A 2pu5_A 2rhw_A* 2rht_A* 2ri6_A | Back alignment and structure |
|---|
| >1wm1_A Proline iminopeptidase; complex with inhibitor, hydrolase; HET: PTB; 2.10A {Serratia marcescens} SCOP: c.69.1.7 PDB: 1qtr_A* 1x2b_A* 1x2e_A* | Back alignment and structure |
|---|
| >1mtz_A Proline iminopeptidase; alpha-beta hydrolase, CAP domain, caged active site, prolyl peptidase; 1.80A {Thermoplasma acidophilum} SCOP: c.69.1.7 PDB: 1mt3_A 1mu0_A* 1xrr_A 1xrq_A 1xro_A 1xrn_A 1xrm_A 1xrp_A 1xrl_A* 1xqw_A* 1xqx_A* 1xqy_A 1xqv_A | Back alignment and structure |
|---|
| >1iup_A META-cleavage product hydrolase; aromatic compounds, cumene, isopropylbenzene, META-cleavage compound hydrolase; 1.60A {Pseudomonas fluorescens} SCOP: c.69.1.10 PDB: 1iun_A 1iuo_A 1uk6_A 1uk7_A 1uk8_A 1uk9_A 1uka_A 1ukb_A 2d0d_A | Back alignment and structure |
|---|
| >3v48_A Aminohydrolase, putative aminoacrylate hydrolase RUTD; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.10A {Escherichia coli SE11} | Back alignment and structure |
|---|
| >3ibt_A 1H-3-hydroxy-4-oxoquinoline 2,4-dioxygenase; QDO, oxidoreductase; 2.60A {Pseudomonas putida} | Back alignment and structure |
|---|
| >3om8_A Probable hydrolase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MES; 2.25A {Pseudomonas aeruginosa} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2qs9_A Retinoblastoma-binding protein 9; B5T overexpressed gene protein, BOG, RBBP9, RBBP10, HR2978, NESG, structural genomics, PSI-2; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3sty_A Methylketone synthase 1; alpha/beta hydrolase, decarboxylase, hydrolase; HET: DKA; 1.70A {Lycopersicon hirsutum F} PDB: 3stu_A* 3stt_A* 3stv_A* 3stw_A* 3stx_A* | Back alignment and structure |
|---|
| >3kda_A CFTR inhibitory factor (CIF); alpha/beta hydrolase, hydrolase; 1.50A {Pseudomonas aeruginosa ucbpp-pa14} PDB: 3kd2_A 3pi6_A | Back alignment and structure |
|---|
| >3u1t_A DMMA haloalkane dehalogenase; alpha/beta-hydrolase, hydrolase; 2.20A {Unidentified} | Back alignment and structure |
|---|
| >4dnp_A DAD2; alpha/beta hydrolase, hydrolase; 2.15A {Petunia hybrida} PDB: 4dnq_A | Back alignment and structure |
|---|
| >2wtm_A EST1E; hydrolase; 1.60A {Clostridium proteoclasticum} PDB: 2wtn_A* | Back alignment and structure |
|---|
| >1u2e_A 2-hydroxy-6-ketonona-2,4-dienedioic acid hydrolase; alpha/beta hydrolase fold; 2.10A {Escherichia coli} | Back alignment and structure |
|---|
| >3r40_A Fluoroacetate dehalogenase; FACD, defluorinase, alpha/beta hydrolase, hydrolase; 1.05A {Rhodopseudomonas palustris} PDB: 3r3w_A 3r3x_A 3r3v_A 3r3u_A 3r3z_A 3r41_A 3r3y_A | Back alignment and structure |
|---|
| >3dqz_A Alpha-hydroxynitrIle lyase-like protein; A/B-hydrloase fold, cyanogenesis; 2.50A {Arabidopsis thaliana} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1zoi_A Esterase; alpha/beta hydrolase fold; 1.60A {Pseudomonas putida} PDB: 4dgq_A | Back alignment and structure |
|---|
| >1c4x_A BPHD, protein (2-hydroxy-6-OXO-6-phenylhexa-2,4-dienoat hydrolase); PCB degradation; 2.40A {Rhodococcus SP} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3bf7_A Esterase YBFF; thioesterase, helical CAP, hydrolase; 1.10A {Escherichia coli} PDB: 3bf8_A | Back alignment and structure |
|---|
| >3l80_A Putative uncharacterized protein SMU.1393C; alpha/beta hydrolase fold, carboxylesterase, Ser- hydrolase; 2.00A {Streptococcus mutans} | Back alignment and structure |
|---|
| >1wom_A RSBQ, sigma factor SIGB regulation protein RSBQ; alpha/beta hydrolase, signaling protein; 2.50A {Bacillus subtilis} PDB: 1wpr_A* | Back alignment and structure |
|---|
| >3i1i_A Homoserine O-acetyltransferase; structural genomics, IDP01610, O-acetyltransfera bacillus anthracis; HET: MSE; 2.44A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3qit_A CURM TE, polyketide synthase; thioesterase, alpha/beta hydrolase, decarboxylase, sulfate elimination, terminal alkene production; 1.68A {Lyngbya majuscula 19L} | Back alignment and structure |
|---|
| >2psd_A Renilla-luciferin 2-monooxygenase; alpha/beta-hydrolase, luciferase, oxidoreductase; 1.40A {Renilla reniformis} PDB: 2pse_A 2psj_A* 2psh_A 2psf_A | Back alignment and structure |
|---|
| >3nwo_A PIP, proline iminopeptidase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, mycobac smegmatis; 1.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1a8q_A Bromoperoxidase A1; haloperoxidase, oxidoreductase; 1.75A {Streptomyces aureofaciens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3qvm_A OLEI00960; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta hydrolase fold, hydrolase; 2.00A {Oleispira antarctica} | Back alignment and structure |
|---|
| >3bwx_A Alpha/beta hydrolase; YP_496220.1, joint center for structural genomics, protein structure initiative, PSI-2; HET: MSE; 1.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3oos_A Alpha/beta hydrolase family protein; APC67239.0, protein structure initiative, PSI-2, structural midwest center for structural genomics, MCSG; HET: MSE PG4; 1.65A {Bacillus anthracis} | Back alignment and structure |
|---|
| >2yys_A Proline iminopeptidase-related protein; TTHA1809, structural genomics, unknown function; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1j1i_A META cleavage compound hydrolase; carbazole degradation, META cleavage product hydrolase, histidine tagged protein, alpha/beta-hydrolase; 1.86A {Janthinobacterium} SCOP: c.69.1.10 | Back alignment and structure |
|---|
| >3pe6_A Monoglyceride lipase; alpha-beta hydrolase fold, 2-arachidonyl-glycerol, M associated, hydrolase, hydrolase-hydrolase inhibitor comple; HET: ZYH; 1.35A {Homo sapiens} PDB: 3jw8_A 3jwe_A* | Back alignment and structure |
|---|
| >1a88_A Chloroperoxidase L; haloperoxidase, oxidoreductase; 1.90A {Streptomyces lividans} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >1auo_A Carboxylesterase; hydrolase; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.14 PDB: 1aur_A* | Back alignment and structure |
|---|
| >4fbl_A LIPS lipolytic enzyme; thermostable, structural genomics, enzyme function initiativ structural proteomics in europe, spine; HET: SPD; 1.99A {Unidentified} PDB: 4fbm_A | Back alignment and structure |
|---|
| >1brt_A Bromoperoxidase A2; haloperoxidase, oxidoreductase, alpha/beta hydrolase fold, mutant M99T; 1.50A {Streptomyces aureofaciens} SCOP: c.69.1.12 PDB: 1bro_A 1a8u_A 1a7u_A | Back alignment and structure |
|---|
| >1r3d_A Conserved hypothetical protein VC1974; structural genomics, hydrolase, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI; 1.90A {Vibrio cholerae} SCOP: c.69.1.35 | Back alignment and structure |
|---|
| >3fsg_A Alpha/beta superfamily hydrolase; PF00561, MCSG, PSI, PSI-2, structural genomics, protein structure initiative, midwest for structural genomics; 2.00A {Oenococcus oeni} | Back alignment and structure |
|---|
| >3e0x_A Lipase-esterase related protein; APC60309, clostridium acetobutylicum ATCC 824, structural genomics, PSI-2; HET: MSE; 1.45A {Clostridium acetobutylicum} | Back alignment and structure |
|---|
| >2pl5_A Homoserine O-acetyltransferase; alpha/beta hydrolase superfa transferase; 2.20A {Leptospira interrogans} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3hju_A Monoglyceride lipase; alpha/beta hydrolase, hydrolase, serine esterase; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3p2m_A Possible hydrolase; alpha/beta hydrolase superfamily; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3afi_E Haloalkane dehalogenase; A/B-hydrolase, hydrolase; 1.75A {Bradyrhizobium japonicum} PDB: 3a2m_A* 3a2n_A 3a2l_A* | Back alignment and structure |
|---|
| >3ksr_A Putative serine hydrolase; catalytic triad, structural genomics, JOIN for structural genomics, JCSG; 2.69A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3h04_A Uncharacterized protein; protein with unknown function, structural genomics, MCSG, PS protein structure initiative; 1.90A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >1a8s_A Chloroperoxidase F; haloperoxidase, oxidoreductase, propionate complex; 1.80A {Pseudomonas fluorescens} SCOP: c.69.1.12 | Back alignment and structure |
|---|
| >3g9x_A Haloalkane dehalogenase; alpha/beta hydrolase, helical CAP domain, catalytic triad (A His272, Glu130), mutant, I135F, haloalkanes; 0.95A {Rhodococcus SP} SCOP: c.69.1.8 PDB: 3fwh_A 3fbw_A 3rlt_A 3rk4_A 1bn6_A 1bn7_A 4fwb_A 1cqw_A 3sk0_A 2v9z_A | Back alignment and structure |
|---|
| >3c5v_A PME-1, protein phosphatase methylesterase 1; demethylase, PP2A, alternative splicing, hydrolase, phosphoprotein, serine esterase; 2.00A {Homo sapiens} PDB: 3c5w_P | Back alignment and structure |
|---|
| >3qyj_A ALR0039 protein; alpha/beta fold, hydrolase; 1.78A {Nostoc SP} | Back alignment and structure |
|---|
| >2xt0_A Haloalkane dehalogenase; hydrolase, alpha-beta hydrolase fold; 1.90A {Plesiocystis pacifica} | Back alignment and structure |
|---|
| >3hss_A Putative bromoperoxidase; alpha beta hydrolase, oxidoreductase, hydrolase; 1.90A {Mycobacterium tuberculosis} PDB: 3e3a_A 3hys_A 3hzo_A | Back alignment and structure |
|---|
| >2qmq_A Protein NDRG2, protein NDR2; alpha/beta-hydrolases fold, NDR family, developmental protei differentiation, neurogenesis, phosphorylation; HET: 2PE; 1.70A {Mus musculus} PDB: 2xmq_A 2xmr_A 2xms_A | Back alignment and structure |
|---|
| >2h1i_A Carboxylesterase; structural genomics, PSI-2, protein struct initiative, midwest center for structural genomics, MCSG, H; HET: MSE; 2.80A {Bacillus cereus} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >2qvb_A Haloalkane dehalogenase 3; RV2579, alpha-beta hydrolase protei structural genomics consortium, TBSGC, hydrolase; 1.19A {Mycobacterium tuberculosis} PDB: 2o2i_A 2o2h_A | Back alignment and structure |
|---|
| >3llc_A Putative hydrolase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE PG4; 1.80A {Agrobacterium vitis} | Back alignment and structure |
|---|
| >2wj6_A 1H-3-hydroxy-4-oxoquinaldine 2,4-dioxygenase; oxidoreductase, alpha/beta hydrolase; HET: ZZ8 SRT; 2.00A {Arthrobacter nitroguajacolicus} PDB: 2wj4_A* 2wj3_A* 2wm2_A* | Back alignment and structure |
|---|
| >2qjw_A Uncharacterized protein XCC1541; putative hydrolase of the alpha/beta superfamily, structural genomics; HET: MSE TLA P6G; 1.35A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1fj2_A Protein (acyl protein thioesterase 1); alpha/beta hydrolase, serine hydrolase, SAD, anomalous diffr hydrolase; 1.50A {Homo sapiens} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >4g9e_A AHL-lactonase, alpha/beta hydrolase fold protein; AHL-binding; HET: C4L; 1.09A {Ochrobactrum} PDB: 4g5x_A* 4g8b_A* 4g8d_A 4g8c_A* 4g9g_A | Back alignment and structure |
|---|
| >3b5e_A MLL8374 protein; NP_108484.1, carboxylesterase, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; 1.75A {Mesorhizobium loti} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >3bdi_A Uncharacterized protein TA0194; NP_393672.1, predicted CIB-like hydrolase, structural genomi center for structural genomics; HET: MSE; 1.45A {Thermoplasma acidophilum dsm 1728} | Back alignment and structure |
|---|
| >3rm3_A MGLP, thermostable monoacylglycerol lipase; alpha/beta hydrolase fold, hydrolase; 1.20A {Bacillus SP} PDB: 3rli_A | Back alignment and structure |
|---|
| >1mj5_A 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase; LINB, haloalkane dehalogenase, 1, 3, 4, 4-cyclohexadiene dehalogenase; 0.95A {Sphingomonas paucimobilis} SCOP: c.69.1.8 PDB: 1cv2_A 1d07_A 2bfn_A 1g42_A* 1g4h_A* 1g5f_A* 1iz7_A 1iz8_A* 1k5p_A 1k63_A 1k6e_A | Back alignment and structure |
|---|
| >3og9_A Protein YAHD A copper inducible hydrolase; alpha/beta hydrolase, copper homeostasis, malic acid; 1.88A {Lactococcus lactis subsp} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2vat_A Acetyl-COA--deacetylcephalosporin C acetyltransferase; A/B- hydrolase fold, acyltransferase, acetyl coenzyme A, antibiotic biosynthesis; HET: COA; 2.2A {Acremonium chrysogenum} SCOP: c.69.1.40 PDB: 2vav_A* 2vax_A* | Back alignment and structure |
|---|
| >4f0j_A Probable hydrolytic enzyme; alpha/beta hydrolase fold, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.50A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2b61_A Homoserine O-acetyltransferase; acyl-enzyme, aspartate pathway, coenzyme A, structure-functi studies, alpha-beta hydrolase fold; 1.65A {Haemophilus influenzae} SCOP: c.69.1.40 | Back alignment and structure |
|---|
| >3ia2_A Arylesterase; alpha-beta hydrolase fold, transition state analog, hydrolas oxidoreductase, peroxidase; 1.65A {Pseudomonas fluorescens} SCOP: c.69.1.12 PDB: 1va4_A 3t52_A* 3t4u_A* 3hi4_A 3hea_A | Back alignment and structure |
|---|
| >1imj_A CIB, CCG1-interacting factor B; alpha/beta hydrolase, CCG1 interactor; 2.20A {Homo sapiens} SCOP: c.69.1.23 | Back alignment and structure |
|---|
| >1tgl_A Triacyl-glycerol acylhydrolase; carboxylic esterase; 1.90A {Rhizomucor miehei} SCOP: c.69.1.17 PDB: 4tgl_A 5tgl_A* 3tgl_A | Back alignment and structure |
|---|
| >3fla_A RIFR; alpha-beta hydrolase thioesterase, hydrolase; HET: MSE; 1.80A {Amycolatopsis mediterranei} PDB: 3flb_A* | Back alignment and structure |
|---|
| >1dqz_A 85C, protein (antigen 85-C); fibronectin, structural genomics, PSI, protein structure initiative, TB structural genomics consortium; 1.50A {Mycobacterium tuberculosis} SCOP: c.69.1.3 PDB: 3hrh_A 1dqy_A 1va5_A* 1f0n_A* 1f0p_A* | Back alignment and structure |
|---|
| >3u0v_A Lysophospholipase-like protein 1; alpha, beta hydrolase fold, hydrolase; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3pfb_A Cinnamoyl esterase; alpha/beta hydrolase fold, hydrolase, cinnamoyl/Fe esterase, hydroxycinammates, extracellular; HET: ZYC; 1.58A {Lactobacillus johnsonii} PDB: 3pf9_A* 3pfc_A* 3s2z_A* 3pf8_A 3qm1_A* | Back alignment and structure |
|---|
| >2y6u_A Peroxisomal membrane protein LPX1; hydrolase, putative esterase, putative lipase; HET: CME CSO; 1.90A {Saccharomyces cerevisiae} PDB: 2y6v_A* | Back alignment and structure |
|---|
| >2o2g_A Dienelactone hydrolase; YP_324580.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.92A {Anabaena variabilis} | Back alignment and structure |
|---|
| >3b12_A Fluoroacetate dehalogenase; dehalogease, hydrolase; 1.20A {Burkholderia SP} PDB: 1y37_A | Back alignment and structure |
|---|
| >3cn9_A Carboxylesterase; alpha/beta hydrolase fold super-family, hydrolase; HET: 2PE; 2.09A {Pseudomonas aeruginosa} PDB: 3cn7_A* | Back alignment and structure |
|---|
| >3fob_A Bromoperoxidase; structural genomics, IDP00046, bacillus ANT peroxidase, oxidoreductase; 1.74A {Bacillus anthracis str} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3ils_A PKS, aflatoxin biosynthesis polyketide synthase; A/B hydrolase, thioesterase, norsolorinic acid, P polyketide, acyltransferase; 1.70A {Aspergillus parasiticus} | Back alignment and structure |
|---|
| >2e3j_A Epoxide hydrolase EPHB; epoxide hydrolase B, structural mycobacterium tuberculosis structural proteomics project, X hydrolase; 2.10A {Mycobacterium tuberculosis} PDB: 2zjf_A* | Back alignment and structure |
|---|
| >2r11_A Carboxylesterase NP; 2632844, putative hydrolase, structural genomics, joint center for structural genomics, JCSG; HET: MSE PGE; 1.96A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2q0x_A Protein DUF1749, uncharacterized protein; alpha/beta hydrolase fold, structural genomics, structural G of pathogenic protozoa consortium; 2.20A {Trypanosoma brucei} | Back alignment and structure |
|---|
| >3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* | Back alignment and structure |
|---|
| >1b6g_A Haloalkane dehalogenase; hydrolase, alpha/beta-hydrolase; 1.15A {Xanthobacter autotrophicus} SCOP: c.69.1.8 PDB: 1be0_A 1cij_A 2yxp_X 1edd_A 1edb_A 2dhc_A 2dhe_A 2eda_A 2edc_A 2had_A 1ede_A 2pky_X 1bez_A 1bee_A 2dhd_A* 1hde_A | Back alignment and structure |
|---|
| >3trd_A Alpha/beta hydrolase; cellular processes; 1.50A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2fuk_A XC6422 protein; A/B hydrolase, structural genomics, X-RAY diffraction; 1.60A {Xanthomonas campestris} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1w52_X Pancreatic lipase related protein 2; detergent, cleaved flap; HET: DDQ; 2.99A {Equus caballus} | Back alignment and structure |
|---|
| >1k8q_A Triacylglycerol lipase, gastric; APHA beta hydrolase fold, hydrolase; HET: NAG BOG C11; 2.70A {Canis lupus familiaris} SCOP: c.69.1.6 PDB: 1hlg_A* | Back alignment and structure |
|---|
| >2r8b_A AGR_C_4453P, uncharacterized protein ATU2452; APC6088, agrobacterium tumefaciens STR. C58 structural genomics, PSI-2; 2.56A {Agrobacterium tumefaciens str} SCOP: c.69.1.14 | Back alignment and structure |
|---|
| >1bu8_A Protein (pancreatic lipase related protein 2); hydrolase, lipid degradation; HET: NAG; 1.80A {Rattus norvegicus} SCOP: b.12.1.2 c.69.1.19 PDB: 2oxe_A* 2pvs_A 1eth_A* | Back alignment and structure |
|---|
| >3lcr_A Tautomycetin biosynthetic PKS; alpha-beta hydrolase, thioesterase, polyketide synthase, phosphopantetheine, transferase, hydrolase; 2.00A {Streptomyces SP} | Back alignment and structure |
|---|
| >1tib_A Lipase; hydrolase(carboxylic esterase); 1.84A {Thermomyces lanuginosus} SCOP: c.69.1.17 PDB: 1dt3_A 1dt5_A 1du4_A 1ein_A* 1dte_A 4dyh_A* 4ea6_A 1gt6_A* | Back alignment and structure |
|---|
| >3dkr_A Esterase D; alpha beta hydrolase, mechanism, catalytic triad, rotation; 1.60A {Lactobacillus rhamnosus} SCOP: c.69.1.0 PDB: 3dlt_A 3dyi_A 3dyv_A 3e1g_A | Back alignment and structure |
|---|
| >3kxp_A Alpha-(N-acetylaminomethylene)succinic acid hydrolase; alpha/beta hydrolase, PLP degradation, E-2- (acetamidomethylene)succinate; 2.26A {Mesorhizobium loti} | Back alignment and structure |
|---|
| >1tht_A Thioesterase; 2.10A {Vibrio harveyi} SCOP: c.69.1.13 | Back alignment and structure |
|---|
| >3tej_A Enterobactin synthase component F; nonribosomal peptide, thioesterase, carrier domain, ATP- BIN enterobactin biosynthesis, ION transport, iron; HET: UF0; 1.90A {Escherichia coli} PDB: 2roq_A | Back alignment and structure |
|---|
| >2rau_A Putative esterase; NP_343859.1, putative lipase, structural genomics, joint CEN structural genomics, JCSG; HET: PG4 UNL; 1.85A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >1gpl_A RP2 lipase; serine esterase, hydrolase, lipid degradation, pancreas, glycoprotein, chimeric; 2.01A {Cavia porcellus} SCOP: b.12.1.2 c.69.1.19 PDB: 1lpb_B* 1lpa_B* 1n8s_A | Back alignment and structure |
|---|
| >1kez_A Erythronolide synthase; polyketide synthase, modular polyketide synthase, thioesterase, 6-DEB, TE, DEBS, alpha, beta-hydrolase; 2.80A {Saccharopolyspora erythraea} SCOP: c.69.1.22 PDB: 1mo2_A | Back alignment and structure |
|---|
| >1lgy_A Lipase, triacylglycerol lipase; hydrolase (carboxylic ester); 2.20A {Rhizopus niveus} SCOP: c.69.1.17 PDB: 1tic_A | Back alignment and structure |
|---|
| >3tjm_A Fatty acid synthase; thioesterase domain, fatty acid synthesis, hydrolase-hydrola inhibitor complex; HET: 7FA; 1.48A {Homo sapiens} PDB: 1xkt_A | Back alignment and structure |
|---|
| >1sfr_A Antigen 85-A; alpha/beta hydrolase, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 2.70A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >3e4d_A Esterase D; S-formylglutathione hydrolase, hydrolase fold family, catalytic triad, kinetics, proposed reaction mechanism; HET: MSE; 2.01A {Agrobacterium tumefaciens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >2i3d_A AGR_C_3351P, hypothetical protein ATU1826; structural genomics, APC5865, hydrolase, PSI-2, protein STRU initiative; HET: MSE; 1.50A {Agrobacterium tumefaciens str} SCOP: c.69.1.36 | Back alignment and structure |
|---|
| >1hpl_A Lipase; hydrolase(carboxylic esterase); 2.30A {Equus caballus} SCOP: b.12.1.2 c.69.1.19 | Back alignment and structure |
|---|
| >3i6y_A Esterase APC40077; lipase, structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic hydrolase; HET: MSE; 1.75A {Oleispira antarctica} PDB: 3s8y_A | Back alignment and structure |
|---|
| >1ufo_A Hypothetical protein TT1662; alpha-beta fold, hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.60A {Thermus thermophilus} SCOP: c.69.1.27 | Back alignment and structure |
|---|
| >3fcx_A FGH, esterase D, S-formylglutathione hydrolase; retinoblastoma, genetic marker, cytoplasm, cytoplasmic vesicle, polymorphism, serine esterase; 1.50A {Homo sapiens} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1jfr_A Lipase; serine hydrolase; 1.90A {Streptomyces exfoliatus} SCOP: c.69.1.16 | Back alignment and structure |
|---|
| >1r88_A MPT51/MPB51 antigen; ALFA/beta hydrolase fold, FBPC1, immune system; 1.71A {Mycobacterium tuberculosis} SCOP: c.69.1.3 | Back alignment and structure |
|---|
| >2uz0_A Esterase, tributyrin esterase; alpha/beta hydrolase, hydrolase, A virulence facto LUNG infection; HET: MSE; 1.7A {Streptococcus pneumoniae} | Back alignment and structure |
|---|
| >3d0k_A Putative poly(3-hydroxybutyrate) depolymerase LPQ; alpha-beta-alpha sandwich, structural genomics, PSI-2; 1.83A {Bordetella parapertussis 12822} | Back alignment and structure |
|---|
| >2pbl_A Putative esterase/lipase/thioesterase; alpha/beta-hydrolases fold, structural genomics, joint cente structural genomics, JCSG; 1.79A {Silicibacter SP} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1jmk_C SRFTE, surfactin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha-beta hydrolase, cyclic peptide; 1.71A {Bacillus subtilis} SCOP: c.69.1.22 | Back alignment and structure |
|---|
| >4b6g_A Putative esterase; hydrolase, formaldehyde detoxification, alpha/beta serine HY; 1.40A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3ls2_A S-formylglutathione hydrolase; psychrophilic organism; 2.20A {Pseudoalteromonas haloplanktis} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >1rp1_A Pancreatic lipase related protein 1; hydrolase, lipid degradation; HET: NAG; 2.10A {Canis lupus familiaris} SCOP: b.12.1.2 c.69.1.19 PDB: 2ppl_A | Back alignment and structure |
|---|
| >3n2z_B Lysosomal Pro-X carboxypeptidase; alpha/beta hydrolase, PRCP, serine carboxypeptidase, hydrola; HET: NAG; 2.79A {Homo sapiens} | Back alignment and structure |
|---|
| >2cb9_A Fengycin synthetase; thioesterase, non-ribosomal peptide synthesis, alpha/beta- hydrolases, catalytic triade, hydrolase; 1.8A {Bacillus subtilis} PDB: 2cbg_A* | Back alignment and structure |
|---|
| >1vkh_A Putative serine hydrolase; structural genomics, joint center structural genomics, JCSG, protein structure initiative, PS hydrolase; HET: MSE; 1.85A {Saccharomyces cerevisiae} SCOP: c.69.1.32 | Back alignment and structure |
|---|
| >3d7r_A Esterase; alpha/beta fold, hydrolase; 2.01A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >3bxp_A Putative lipase/esterase; putative carboxylesterase, structural genomics, joint center structural genomics, JCSG; HET: EPE; 1.70A {Lactobacillus plantarum WCFS1} PDB: 3d3n_A* | Back alignment and structure |
|---|
| >3qmv_A Thioesterase, REDJ; alpha/beta hydrolase fold, hydrolase; 2.12A {Streptomyces coelicolor} PDB: 3qmw_A* | Back alignment and structure |
|---|
| >4h0c_A Phospholipase/carboxylesterase; PSI-biology, midwest center for structural genomics, MCSG, hydrolase; HET: CIT; 1.62A {Dyadobacter fermentans} | Back alignment and structure |
|---|
| >4i19_A Epoxide hydrolase; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; 2.15A {Streptomyces carzinostaticus subsp} | Back alignment and structure |
|---|
| >2hfk_A Pikromycin, type I polyketide synthase pikaiv; alpha/beta hydrolase, thioesterase; HET: E4H; 1.79A {Streptomyces venezuelae} PDB: 2h7x_A* 2h7y_A* 2hfj_A* 1mna_A 1mn6_A 1mnq_A | Back alignment and structure |
|---|
| >1qlw_A Esterase; anisotropic refinement, atomic resolution, alpha/beta hydrolase; 1.09A {Alcaligenes SP} SCOP: c.69.1.15 PDB: 2wkw_A* | Back alignment and structure |
|---|
| >3k2i_A Acyl-coenzyme A thioesterase 4; alpha/beta hydrolase fold seven-stranded beta-sandwich, structural genomics, structural genomics consortium, SGC; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1jjf_A Xylanase Z, endo-1,4-beta-xylanase Z, 1,4-beta-D-xylan; feruloyl esterase, ferulic acid esterase, FAE_XYNZ, XYNZ, structural genomics; 1.75A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1jt2_A* | Back alignment and structure |
|---|
| >3bjr_A Putative carboxylesterase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 2.09A {Lactobacillus plantarum WCFS1} | Back alignment and structure |
|---|
| >1zi8_A Carboxymethylenebutenolidase; alpha and beta proteins, 3-D structure, serine esterase, HYD aromatic hydrocarbons, catabolism; 1.40A {Pseudomonas putida} PDB: 1zj5_A* 1zi9_A 1zi6_A 1zj4_A* 1din_A 1ziy_A* 1zic_A 1zix_A 1ggv_A* | Back alignment and structure |
|---|
| >4f21_A Carboxylesterase/phospholipase family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.50A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >1tia_A Lipase; hydrolase(carboxylic esterase); 2.10A {Penicillium camemberti} SCOP: c.69.1.17 | Back alignment and structure |
|---|
| >4fle_A Esterase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein, rossmann fold, HY; 2.10A {Yersinia enterocolitica subsp} | Back alignment and structure |
|---|
| >3qpa_A Cutinase; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted; HET: MIR; 0.85A {Nectria haematococca} PDB: 3qpc_A* 1cex_A 1oxm_A* 1cui_A 1cus_A 2cut_A 1cuj_A 1cuy_A 1xzl_A* 1xzk_A* 1xzm_A* 1cuh_A 1cuu_A 3esc_A* 1cua_A* 3esa_A* 3esb_A* 3ef3_A* 3esd_A* 1cux_A ... | Back alignment and structure |
|---|
| >3hlk_A Acyl-coenzyme A thioesterase 2, mitochondrial; alpha/beta hydrolase, alternative splicing, hydrolase, mitochondrion, polymorphism, serine esterase; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2dst_A Hypothetical protein TTHA1544; conserved hypothetical protein, structural genomics, NPPSFA; 2.00A {Thermus thermophilus} SCOP: c.69.1.39 | Back alignment and structure |
|---|
| >1ycd_A Hypothetical 27.3 kDa protein in AAP1-SMF2 intergenic region; esterase, lipase, serine hydrolase, structural genomics; HET: LI5; 1.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2k2q_B Surfactin synthetase thioesterase subunit; A/B-hydrolase, NRPS, non-ribosomal peptide synthetase, type II thioesterase, antibiotic biosynthesis; NMR {Bacillus subtilis} PDB: 2ron_A | Back alignment and structure |
|---|
| >3vis_A Esterase; alpha/beta-hydrolase fold, polyethylene terephthal hydrolase; HET: PE4; 1.76A {Thermobifida alba} | Back alignment and structure |
|---|
| >2hm7_A Carboxylesterase; alpha/beta hydrolase fold, hydrolase; 2.00A {Alicyclobacillus acidocaldarius} PDB: 1evq_A* 1u4n_A 1qz3_A | Back alignment and structure |
|---|
| >3doh_A Esterase; alpha-beta hydrolase, beta sheet; 2.60A {Thermotoga maritima} PDB: 3doi_A | Back alignment and structure |
|---|
| >3fcy_A Xylan esterase 1; alpha/beta hydrolase, carbohydrate esterase, CE7; 2.10A {Thermoanaerobacterium SP} | Back alignment and structure |
|---|
| >2zsh_A Probable gibberellin receptor GID1L1; plant hormone receptor, gibberellin, gibberellin signaling pathway, hydrolase, nucleus, receptor, developmental protein; HET: GA3; 1.80A {Arabidopsis thaliana} PDB: 2zsi_A* | Back alignment and structure |
|---|
| >4fhz_A Phospholipase/carboxylesterase; alpha/beta hydrolase superfamily, central beta-STR sheet, flanked alpha helices, hydrolase; 2.01A {Rhodobacter sphaeroides} PDB: 4ftw_A* | Back alignment and structure |
|---|
| >3vdx_A Designed 16NM tetrahedral protein CAGE containing bromoperoxidase BPO-A2 and matrix...; protein design, bionanotechnology; 3.00A {Streptomyces aureofaciens} PDB: 4d9j_A | Back alignment and structure |
|---|
| >3f67_A Putative dienelactone hydrolase; alpha-beta-alpha sandwich, structural genomics, PSI-2, prote structure initiative; 1.74A {Klebsiella pneumoniae subsp} | Back alignment and structure |
|---|
| >4e15_A Kynurenine formamidase; alpha/beta hydrolase fold, hydrolase-hydrolase inhibitor COM; HET: SEB; 1.50A {Drosophila melanogaster} PDB: 4e14_A* 4e11_A | Back alignment and structure |
|---|
| >3hxk_A Sugar hydrolase; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 3.20A {Lactococcus lactis subsp} | Back alignment and structure |
|---|
| >3mve_A FRSA, UPF0255 protein VV1_0328; FRSA,fermentation/respiration switch protein, hydrolase ACTI lyase; 2.20A {Vibrio vulnificus} PDB: 3our_A | Back alignment and structure |
|---|
| >2fx5_A Lipase; alpha-beta hydrolase; HET: TLA; 1.80A {Pseudomonas mendocina} | Back alignment and structure |
|---|
| >2hdw_A Hypothetical protein PA2218; alpha/beta hydrolase fold, structural genomics, PSI, structure initiative; 2.00A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >2c7b_A Carboxylesterase, ESTE1; carboxyesterase, thermophilic enzyme, hydrolase, HSL, alpha/beta hydrolase fold; 2.3A {Uncultured archaeon} | Back alignment and structure |
|---|
| >1uwc_A Feruloyl esterase A; hydrolase, serine esterase, xylan degradation; HET: NAG FER; 1.08A {Aspergillus niger} SCOP: c.69.1.17 PDB: 1uza_A* 2hl6_A* 2ix9_A* 1usw_A* 2bjh_A* | Back alignment and structure |
|---|
| >2px6_A Thioesterase domain; thioesaterse domain, orlistat, fatty acid synthase, drug complex, tetrahydrolipstatin, transferase; HET: DH9; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >2o7r_A CXE carboxylesterase; alpha/beta hydrolase; 1.40A {Actinidia eriantha} PDB: 2o7v_A | Back alignment and structure |
|---|
| >1l7a_A Cephalosporin C deacetylase; structural genomics, alpha-beta-alpha sandwich, PSI, protein structure initiative; 1.50A {Bacillus subtilis} SCOP: c.69.1.25 PDB: 1odt_C 1ods_A 3fvt_A 3fvr_A 3fyu_A* 2xlb_A 2xlc_A 3fyt_A* 3fyu_B* | Back alignment and structure |
|---|
| >3o0d_A YALI0A20350P, triacylglycerol lipase; alpha/beta-hydrolase, lipids binding, glycosylation, extracellular, hydrolase; HET: NAG; 1.70A {Yarrowia lipolytica} SCOP: c.69.1.0 | Back alignment and structure |
|---|
| >3qpd_A Cutinase 1; alpha-beta hydrolase fold, esterase, hydrolase, mono- phosphorylated serine residue, secreted, phosphorylated Ser residue; HET: SEP; 1.57A {Aspergillus oryzae} PDB: 3gbs_A | Back alignment and structure |
|---|
| >3fnb_A Acylaminoacyl peptidase SMU_737; alpha-beta-alpha sandwich, helix bundle, structural genomics protein structure initiative; HET: PGE; 2.12A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2jbw_A Dhpon-hydrolase, 2,6-dihydroxy-pseudo-oxynicotine hydrolase; alpha/beta hydrolase, META-cleavage pathway; 2.1A {Arthrobacter nicotinovorans} SCOP: c.69.1.41 | Back alignment and structure |
|---|
| >1jji_A Carboxylesterase; alpha-beta hydrolase fold, hydrolase; HET: EPE; 2.20A {Archaeoglobus fulgidus} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >1gkl_A Endo-1,4-beta-xylanase Y; hydrolase, esterase family 1, inactive mutant; HET: FER; 1.4A {Clostridium thermocellum} SCOP: c.69.1.2 PDB: 1wb4_A* 1wb5_A* 1wb6_A* 1gkk_A* | Back alignment and structure |
|---|
| >3ngm_A Extracellular lipase; secret lipase, hydrolase; 2.80A {Gibberella zeae} | Back alignment and structure |
|---|
| >1vlq_A Acetyl xylan esterase; TM0077, structural genomics, JCSG, PR structure initiative, PSI, joint center for structural GENO hydrolase; 2.10A {Thermotoga maritima} SCOP: c.69.1.25 PDB: 3m81_A 3m83_A* 3m82_A* | Back alignment and structure |
|---|
| >3dcn_A Cutinase, cutin hydrolase; catalytic triad, secreted, serine esterase; 1.90A {Glomerella cingulata} SCOP: c.69.1.0 PDB: 3dd5_A 3dea_A* | Back alignment and structure |
|---|
| >2czq_A Cutinase-like protein; alpha/beta hydrolase fold, hydrolase; HET: CIT; 1.05A {Cryptococcus SP} | Back alignment and structure |
|---|
| >1lzl_A Heroin esterase; alpha/beta hydrolase; 1.30A {Rhodococcus SP} SCOP: c.69.1.2 PDB: 1lzk_A | Back alignment and structure |
|---|
| >2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* | Back alignment and structure |
|---|
| >3hc7_A Gene 12 protein, GP12; alpha/beta sandwich, cell adhesion; 2.00A {Mycobacterium phage D29} | Back alignment and structure |
|---|
| >3c8d_A Enterochelin esterase; alpha-beta-alpha sandwich, IROD, iron aquisition, structural genomics, PSI-2, protein structure initiative; HET: CIT; 1.80A {Shigella flexneri 2a str} SCOP: b.1.18.20 c.69.1.2 PDB: 2b20_A 3c87_A* 3c8h_A 3mga_A* | Back alignment and structure |
|---|
| >3k6k_A Esterase/lipase; alpha/beta hydrolase fold; 2.20A {Uncultured bacterium} PDB: 3dnm_A | Back alignment and structure |
|---|
| >3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A | Back alignment and structure |
|---|
| >2qm0_A BES; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: SVY; 1.84A {Bacillus cereus atcc 14579} | Back alignment and structure |
|---|
| >2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} | Back alignment and structure |
|---|
| >1qoz_A AXE, acetyl xylan esterase; hydrolase, xylan degradation; HET: NAG; 1.90A {Trichoderma reesei} SCOP: c.69.1.30 | Back alignment and structure |
|---|
| >3fak_A Esterase/lipase, ESTE5; HSL, hydrolase; 1.90A {Uncultured bacterium} PDB: 3g9t_A 3g9u_A 3g9z_A 3h17_A* 3h18_A* 3h19_A 3h1a_A 3h1b_A 3l1h_A 3l1i_A 3l1j_A 3v9a_A | Back alignment and structure |
|---|
| >1g66_A Acetyl xylan esterase II; serine hydrolase, acetyl xylopyranose, hydrolase; 0.90A {Penicillium purpurogenum} SCOP: c.69.1.30 PDB: 1bs9_A 2axe_A* | Back alignment and structure |
|---|
| >3aja_A Putative uncharacterized protein; alpha-beta hydrolase, serine esterase, cutinase, lipase, HYD; 2.90A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >1z68_A Fibroblast activation protein, alpha subunit; seprase, fibroblast activation protein alpha,fapalpha, dipeptidylpeptidase,S9B; HET: NAG NDG; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3d59_A Platelet-activating factor acetylhydrolase; secreted protein, alpha/beta-hydrolase-fold, LDL-bound, lipoprotein associated phospholipase A2, LP-PLA2; 1.50A {Homo sapiens} PDB: 3d5e_A 3f97_A* 3f98_A 3f9c_A* 3f96_A* | Back alignment and structure |
|---|
| >1jkm_A Brefeldin A esterase; serine hydrolase, degradation of brefeldin A, alpha/beta hydrolase family; 1.85A {Bacillus subtilis} SCOP: c.69.1.2 | Back alignment and structure |
|---|
| >3g02_A Epoxide hydrolase; alpha/beta hydrolase fold, enantioselective, mutant, directed evolution; 1.50A {Aspergillus niger} SCOP: c.69.1.11 PDB: 1qo7_A 3g0i_A* | Back alignment and structure |
|---|
| >2qru_A Uncharacterized protein; alpha/beta-hydrolase, structural GENO PSI-2, protein structure initiative, midwest center for STR genomics, MCSG; 1.65A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >3uue_A LIP1, secretory lipase (family 3); LID-domain, hydrolase; HET: NAG BMA MAN; 1.45A {Malassezia globosa} PDB: 3uuf_A* | Back alignment and structure |
|---|
| >3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A | Back alignment and structure |
|---|
| >3ain_A 303AA long hypothetical esterase; carboxylesterase, thermophilic, dimer, archaea, R267G, hydro; 1.65A {Sulfolobus tokodaii} PDB: 3aio_A 3ail_A 3aik_A 3aim_A | Back alignment and structure |
|---|
| >3g7n_A Lipase; hydrolase fold, hydrolase; HET: 1PE; 1.30A {Penicillium expansum} | Back alignment and structure |
|---|
| >3h2g_A Esterase; xanthomonas oryzae PV. oryzae, cell WALL degrading enzyme, RICE, virulence, innate immune responses, pathogenesis; 1.86A {Xanthomonas oryzae PV} PDB: 3h2j_A 3h2k_A* 3h2h_A 3h2i_A | Back alignment and structure |
|---|
| >4ezi_A Uncharacterized protein; alpha-beta hydrolases fold, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.15A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3qh4_A Esterase LIPW; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, tuberculosis, O LIPW, heroin esterase; 1.75A {Mycobacterium marinum} | Back alignment and structure |
|---|
| >2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* | Back alignment and structure |
|---|
| >2gzs_A IROE protein; enterobactin, salmochelin, DFP, hydrolase, catalytic DYAD; HET: DFP; 1.40A {Escherichia coli} SCOP: c.69.1.38 PDB: 2gzr_A* | Back alignment and structure |
|---|
| >4a5s_A Dipeptidyl peptidase 4 soluble form; hydrolase, type 2 diabetes, novartis compound NVP-BIV988; HET: N7F NAG MAN; 1.62A {Homo sapiens} PDB: 2qjr_A* 3f8s_A* 2qt9_A* 2qtb_A* 2rip_A* 1tk3_A* 1n1m_A* 1nu8_A* 1rwq_A* 1nu6_A* 1tkr_A* 1w1i_A* 2ajl_I* 2bgn_A* 2bub_A* 2ogz_A* 2ole_A* 2oqi_A* 3bjm_A* 3eio_A* ... | Back alignment and structure |
|---|
| >1xfd_A DIP, dipeptidyl aminopeptidase-like protein 6, dipeptidylpeptidase 6; DPPX, DPP6, KV4, KV, KAF, membrane protein; HET: NDG NAG BMA MAN; 3.00A {Homo sapiens} SCOP: b.70.3.1 c.69.1.24 | Back alignment and structure |
|---|
| >2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} | Back alignment and structure |
|---|
| >3gff_A IROE-like serine hydrolase; NP_718593.1, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; 2.12A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} | Back alignment and structure |
|---|
| >3ga7_A Acetyl esterase; phosphoserine, IDP00896, hydrolase, serine structural genomics, center for structural genomics of INFE diseases, csgid; HET: SEP MSE; 1.55A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3ebl_A Gibberellin receptor GID1; alpha/beta hydrolase, lipase, gibberellin signaling pathway, hydrolase, nucleus, hydrolase receptor; HET: GA4; 1.90A {Oryza sativa subsp} PDB: 3ed1_A* | Back alignment and structure |
|---|
| >3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* | Back alignment and structure |
|---|
| >3g8y_A SUSD/RAGB-associated esterase-like protein; structural genom joint center for structural genomics, JCSG; HET: MSE; 1.90A {Bacteroides vulgatus atcc 8482} | Back alignment and structure |
|---|
| >2ory_A Lipase; alpha/beta hydrolase, hydrolase; 2.20A {Photobacterium SP} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 258 | ||||
| d1ei9a_ | 279 | c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {C | 5e-91 | |
| d1pjaa_ | 268 | c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {H | 2e-29 | |
| d1ispa_ | 179 | c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: | 0.001 |
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 279 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Thioesterases domain: Palmitoyl protein thioesterase 1 species: Cow (Bos taurus) [TaxId: 9913]
Score = 268 bits (686), Expect = 5e-91
Identities = 69/208 (33%), Positives = 111/208 (53%), Gaps = 5/208 (2%)
Query: 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLC--GSGIFC 58
+L +GYN +G SQG R V + C PP+ N +S+GG H G +P C S C
Sbjct: 75 DPKLQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHIC 133
Query: 59 IIANNLIKAEVYSDYVQDHLAPSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKEC 118
+ A Y+ +Q+ L + Y P Y FL +N E N +YK+
Sbjct: 134 DFIRKTLNAGAYNKAIQERLVQAEYWHDPIREDIYRNHSIFLADINQERG--VNESYKKN 191
Query: 119 FSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPPQKTKLYTEDWIGLKTLDDAG 178
+L+ V++ F +D ++ P ++ WFG+Y G +P Q++ LYT+D +GLK +D AG
Sbjct: 192 LMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPLQESTLYTQDRLGLKAMDKAG 251
Query: 179 RVHFISVAGGHLKISKADMKKHIIPYLK 206
++ F+++ G HL++S+ HIIP+L+
Sbjct: 252 QLVFLALEGDHLQLSEEWFYAHIIPFLE 279
|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 268 | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} Length = 179 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1ei9a_ | 279 | Palmitoyl protein thioesterase 1 {Cow (Bos taurus) | 100.0 | |
| d1pjaa_ | 268 | Palmitoyl protein thioesterase 2 {Human (Homo sapi | 99.94 | |
| d1tcaa_ | 317 | Triacylglycerol lipase {Yeast (Candida antarctica) | 99.4 | |
| d1ispa_ | 179 | Lipase A {Bacillus subtilis [TaxId: 1423]} | 98.91 | |
| d1ku0a_ | 388 | Lipase L1 {Bacillus stearothermophilus [TaxId: 142 | 98.56 | |
| d1ex9a_ | 285 | Lipase {Pseudomonas aeruginosa [TaxId: 287]} | 98.48 | |
| d1cvla_ | 319 | Lipase {Chromobacterium viscosum [TaxId: 42739]} | 98.34 | |
| d1hkha_ | 279 | Gamma-lactamase {Aureobacterium sp. [TaxId: 51671] | 97.5 | |
| d1jmkc_ | 230 | Surfactin synthetase, SrfA {Bacillus subtilis [Tax | 97.42 | |
| d1m33a_ | 256 | Biotin biosynthesis protein BioH {Escherichia coli | 97.33 | |
| d1zd3a2 | 322 | Mammalian epoxide hydrolase, C-terminal domain {Hu | 96.67 | |
| d1mtza_ | 290 | Tricorn interacting factor F1 {Archaeon Thermoplas | 96.64 | |
| d1brta_ | 277 | Bromoperoxidase A2 {Streptomyces aureofaciens [Tax | 96.55 | |
| d3c70a1 | 256 | Hydroxynitrile lyase {Rubber tree (Hevea brasilien | 96.55 | |
| d1c4xa_ | 281 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 96.49 | |
| d1q0ra_ | 297 | Aclacinomycin methylesterase RdmC {Streptomyces pu | 96.35 | |
| d1j1ia_ | 268 | Meta cleavage compound hydrolase CarC {Janthinobac | 96.26 | |
| d1ehya_ | 293 | Bacterial epoxide hydrolase {Agrobacterium radioba | 96.19 | |
| d1uxoa_ | 186 | Hypothetical protein YdeN {Bacillus subtilis [TaxI | 96.09 | |
| d2rhwa1 | 283 | 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolas | 96.05 | |
| d1uk8a_ | 271 | Meta-cleavage product hydrolase CumD {Pseudomonas | 96.0 | |
| d1b6ga_ | 310 | Haloalkane dehalogenase {Xanthobacter autotrophicu | 95.96 | |
| d1mj5a_ | 298 | Haloalkane dehalogenase {Sphingomonas paucimobilis | 95.83 | |
| d1imja_ | 208 | Ccg1/TafII250-interacting factor B (Cib) {Human (H | 95.78 | |
| d1xkla_ | 258 | Salicylic acid-binding protein 2 (SABP2) {Common t | 95.57 | |
| d1bn7a_ | 291 | Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1 | 95.4 | |
| d1azwa_ | 313 | Proline iminopeptidase {Xanthomonas campestris, pv | 95.2 | |
| d1xkta_ | 286 | Fatty acid synthase {Human (Homo sapiens) [TaxId: | 95.18 | |
| d1a8qa_ | 274 | Bromoperoxidase A1 {Streptomyces aureofaciens [Tax | 95.08 | |
| d1k8qa_ | 377 | Gastric lipase {Dog (Canis familiaris) [TaxId: 961 | 95.03 | |
| d1r3da_ | 264 | Hypothetical protein VC1974 {Vibrio cholerae [TaxI | 94.97 | |
| d3b5ea1 | 209 | Uncharacterized protein Mll8374 {Mesorhizobium lot | 93.53 | |
| d1fj2a_ | 229 | Acyl protein thioesterase 1 {Human (Homo sapiens) | 93.28 | |
| d2h7xa1 | 283 | Picromycin polyketide synthase {Streptomyces venez | 93.24 | |
| d1cexa_ | 197 | Cutinase {Fungus (Fusarium solani), subsp. pisi [T | 92.92 | |
| d1va4a_ | 271 | Arylesterase {Pseudomonas fluorescens [TaxId: 294] | 92.47 | |
| d1tqha_ | 242 | Carboxylesterase Est {Bacillus stearothermophilus | 92.4 | |
| d1a88a_ | 275 | Chloroperoxidase L {Streptomyces lividans [TaxId: | 92.33 | |
| d1thta_ | 302 | Myristoyl-ACP-specific thioesterase {Vibrio harvey | 91.84 | |
| d1mo2a_ | 255 | Erythromycin polyketide synthase {Saccharopolyspor | 90.54 | |
| d1tiba_ | 269 | Triacylglycerol lipase {Thermomyces lanuginosus, f | 90.14 | |
| d1a8sa_ | 273 | Chloroperoxidase F {Pseudomonas fluorescens [TaxId | 89.95 | |
| d2b61a1 | 357 | Homoserine O-acetyltransferase {Haemophilus influe | 89.82 | |
| d1auoa_ | 218 | Carboxylesterase {Pseudomonas fluorescens [TaxId: | 89.8 | |
| d2pl5a1 | 362 | Homoserine O-acetyltransferase {Leptospira interro | 89.79 | |
| d2h1ia1 | 202 | Carboxylesterase {Bacillus cereus [TaxId: 1396]} | 89.76 | |
| d1uwca_ | 261 | Feruloyl esterase A {Aspergillus niger [TaxId: 506 | 89.66 | |
| d2vata1 | 376 | Acetyl-CoA:deacetylcephalosporin C acetyltransfera | 89.63 | |
| d1bu8a2 | 338 | Pancreatic lipase, N-terminal domain {Rat (Rattus | 89.47 | |
| d2r8ba1 | 203 | Uncharacterized protein Atu2452 {Agrobacterium tum | 89.06 | |
| d2fuka1 | 218 | XC6422 protein {Xanthomonas campestris [TaxId: 339 | 89.03 | |
| d2jbwa1 | 360 | 2,6-dihydropseudooxynicotine hydrolase {Arthrobact | 88.69 | |
| d1rp1a2 | 337 | Pancreatic lipase, N-terminal domain {Dog (Canis f | 87.98 | |
| d1wb4a1 | 273 | Feruloyl esterase domain of the cellulosomal xylan | 87.22 | |
| d1jjfa_ | 255 | Feruloyl esterase domain of the cellulosomal xylan | 87.16 | |
| d1tiaa_ | 271 | Triacylglycerol lipase {Penicillium camembertii [T | 87.16 | |
| d1lgya_ | 265 | Triacylglycerol lipase {Rhizopus niveus [TaxId: 48 | 87.13 | |
| d1g66a_ | 207 | Acetylxylan esterase {Penicillium purpurogenum [Ta | 86.32 | |
| d1qoza_ | 207 | Acetylxylan esterase {Trichoderma reesei [TaxId: 5 | 85.86 | |
| d3tgla_ | 265 | Triacylglycerol lipase {Rhizomucor miehei [TaxId: | 85.53 | |
| d1xfda2 | 258 | Dipeptidyl aminopeptidase-like protein 6, DPP6, C- | 85.17 | |
| d1wm1a_ | 313 | Proline aminopeptidase {Serratia marcescens [TaxId | 84.73 | |
| d3c8da2 | 246 | Enterochelin esterase, catalytic domain {Shigella | 83.1 | |
| d1sfra_ | 288 | Antigen 85a {Mycobacterium tuberculosis [TaxId: 17 | 82.59 | |
| d1dqza_ | 280 | Antigen 85c {Mycobacterium tuberculosis [TaxId: 17 | 82.34 | |
| d1ufoa_ | 238 | Hypothetical protein TT1662 {Thermus thermophilus | 80.9 |
| >d1ei9a_ c.69.1.13 (A:) Palmitoyl protein thioesterase 1 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: alpha/beta-Hydrolases superfamily: alpha/beta-Hydrolases family: Thioesterases domain: Palmitoyl protein thioesterase 1 species: Cow (Bos taurus) [TaxId: 9913]
Probab=100.00 E-value=2.4e-74 Score=524.96 Aligned_cols=203 Identities=34% Similarity=0.684 Sum_probs=195.8
Q ss_pred CccCCCcccEEEeChhhHHHHHHHHhcCCCCCcceEEEecCCCCCcccccCCC--ChhHHHHHHHhHhhhcccHHhhhcc
Q 025062 1 MKELSEGYNIVGLSQGNLIGRGVVEFCEGGPPVKNFVSLGGPHAGTASVPLCG--SGIFCIIANNLIKAEVYSDYVQDHL 78 (258)
Q Consensus 1 ~~~l~~GvnlIGhSQGGli~Rayiq~~~g~~kV~nlISLggPh~G~~~~P~c~--~~~lc~~~~~ll~~~~Y~~~vQ~~l 78 (258)
++++++|||+|||||||+|+|+|+|+|++ ++|++||||||||+|++++|.|. ++++|++++.+++..+|++++|+++
T Consensus 75 ~~~~~~~v~lVGhSqGGLiaR~~i~~~~~-~~V~~lITLgsPH~Gv~~~p~c~~~~~~~c~~~~~~l~~~~y~~~~Q~~l 153 (279)
T d1ei9a_ 75 DPKLQQGYNAMGFSQGGQFLRAVAQRCPS-PPMVNLISVGGQHQGVFGLPRCPGESSHICDFIRKTLNAGAYNKAIQERL 153 (279)
T ss_dssp CGGGTTCEEEEEETTHHHHHHHHHHHCCS-SCEEEEEEESCCTTCBCSCTTCCSTTCHHHHHHHHHTHHHHTSHHHHHHC
T ss_pred ccccccceeEEEEccccHHHHHHHHHcCC-CCcceEEEECCCCCCccCCccCCCcchhHHHHHHHHHHhhhhHHHHhhce
Confidence 35778999999999999999999999996 69999999999999999999996 5799999999999999999999999
Q ss_pred ccCCccCCCCChhhhhhcCcchHHHHcCCCCCCchhHHHhhhccCCeEEEEeCCCcEeecCCcCcccccCCCCCcccccC
Q 025062 79 APSGYLKFPNDIPKYLEKCKFLPKLNNELPDKRNSTYKECFSSLQNLVLIMFKDDKVLIPKETAWFGYYPDGAFSPVLPP 158 (258)
Q Consensus 79 ~~A~Y~rdP~~~~~yl~~S~FL~~LNne~~~~~n~~Yk~nf~~L~~~vli~~~~D~vV~P~eSs~Fg~y~~~~~~~vvpm 158 (258)
++|||||||.++++|+++|.|||+||||+ ..|.+||+||.+|++||||+|++|+||+||||||||||++++.++||||
T Consensus 154 ~~a~Yw~dp~~~~~Y~~~s~fL~~iNne~--~~n~~~k~nl~~l~~~vli~~~~D~vv~P~eSs~f~~y~~~~~~~v~~~ 231 (279)
T d1ei9a_ 154 VQAEYWHDPIREDIYRNHSIFLADINQER--GVNESYKKNLMALKKFVMVKFLNDTIVDPVDSEWFGFYRSGQAKETIPL 231 (279)
T ss_dssp TGGGGBCCSTTHHHHHHHCSSHHHHTTTT--SCCHHHHHHHHTSSEEEEEEETTCSSSSSGGGGGTCEECTTCSSCEECG
T ss_pred eccchhcCcchHhhhhhhhhHHHHHhCCc--cCChHHHHHHHhhccEEEEEeCCCceECCCCcceeeeccCCCCceEech
Confidence 99999999999999999999999999997 5699999999999999999999999999999999999998887899999
Q ss_pred cccccccccccchHhHhhcCCeEEEeecCCcceecHHHHHHhhHhhhc
Q 025062 159 QKTKLYTEDWIGLKTLDDAGRVHFISVAGGHLKISKADMKKHIIPYLK 206 (258)
Q Consensus 159 ~et~~Y~eD~iGLktLde~G~l~f~~v~G~H~~~~~~~~~~~i~pyl~ 206 (258)
+||++|+||||||||||++|||+|+++||+||+|++++|.++|+|||+
T Consensus 232 ~~~~~Y~~D~~GLk~ld~~g~l~~~~~~g~H~~~~~~~~~~~i~~~L~ 279 (279)
T d1ei9a_ 232 QESTLYTQDRLGLKAMDKAGQLVFLALEGDHLQLSEEWFYAHIIPFLE 279 (279)
T ss_dssp GGSHHHHTTSSSHHHHHHTTCEEEEEESSSTTCCCHHHHHHHTGGGTC
T ss_pred hhcccHhhhhhCHHhHHHCCCeEEEEeCCccceecHHHHHHhhHhhcC
Confidence 999999999999999999999999999999999999999999999995
|
| >d1pjaa_ c.69.1.13 (A:) Palmitoyl protein thioesterase 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tcaa_ c.69.1.17 (A:) Triacylglycerol lipase {Yeast (Candida antarctica), form b [TaxId: 34362]} | Back information, alignment and structure |
|---|
| >d1ispa_ c.69.1.18 (A:) Lipase A {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1ku0a_ c.69.1.18 (A:) Lipase L1 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ex9a_ c.69.1.18 (A:) Lipase {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1cvla_ c.69.1.18 (A:) Lipase {Chromobacterium viscosum [TaxId: 42739]} | Back information, alignment and structure |
|---|
| >d1hkha_ c.69.1.12 (A:) Gamma-lactamase {Aureobacterium sp. [TaxId: 51671]} | Back information, alignment and structure |
|---|
| >d1jmkc_ c.69.1.22 (C:) Surfactin synthetase, SrfA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1m33a_ c.69.1.26 (A:) Biotin biosynthesis protein BioH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zd3a2 c.69.1.11 (A:225-547) Mammalian epoxide hydrolase, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mtza_ c.69.1.7 (A:) Tricorn interacting factor F1 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} | Back information, alignment and structure |
|---|
| >d1brta_ c.69.1.12 (A:) Bromoperoxidase A2 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d3c70a1 c.69.1.20 (A:2-257) Hydroxynitrile lyase {Rubber tree (Hevea brasiliensis) [TaxId: 3981]} | Back information, alignment and structure |
|---|
| >d1c4xa_ c.69.1.10 (A:) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Rhodococcus sp., strain rha1 [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1q0ra_ c.69.1.28 (A:) Aclacinomycin methylesterase RdmC {Streptomyces purpurascens [TaxId: 1924]} | Back information, alignment and structure |
|---|
| >d1j1ia_ c.69.1.10 (A:) Meta cleavage compound hydrolase CarC {Janthinobacterium sp. J3 [TaxId: 213804]} | Back information, alignment and structure |
|---|
| >d1ehya_ c.69.1.11 (A:) Bacterial epoxide hydrolase {Agrobacterium radiobacter [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1uxoa_ c.69.1.31 (A:) Hypothetical protein YdeN {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2rhwa1 c.69.1.10 (A:4-286) 2-hydroxy-6-oxo-6-phenylhexa-2,4-dienoate hydrolase (BPHD) {Burkholderia xenovorans [TaxId: 36873]} | Back information, alignment and structure |
|---|
| >d1uk8a_ c.69.1.10 (A:) Meta-cleavage product hydrolase CumD {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1b6ga_ c.69.1.8 (A:) Haloalkane dehalogenase {Xanthobacter autotrophicus [TaxId: 280]} | Back information, alignment and structure |
|---|
| >d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas paucimobilis, UT26, LinB [TaxId: 13689]} | Back information, alignment and structure |
|---|
| >d1imja_ c.69.1.23 (A:) Ccg1/TafII250-interacting factor B (Cib) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkla_ c.69.1.20 (A:) Salicylic acid-binding protein 2 (SABP2) {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1bn7a_ c.69.1.8 (A:) Haloalkane dehalogenase {Rhodococcus sp. [TaxId: 1831]} | Back information, alignment and structure |
|---|
| >d1azwa_ c.69.1.7 (A:) Proline iminopeptidase {Xanthomonas campestris, pv. citri [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d1xkta_ c.69.1.22 (A:) Fatty acid synthase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a8qa_ c.69.1.12 (A:) Bromoperoxidase A1 {Streptomyces aureofaciens [TaxId: 1894]} | Back information, alignment and structure |
|---|
| >d1k8qa_ c.69.1.6 (A:) Gastric lipase {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1r3da_ c.69.1.35 (A:) Hypothetical protein VC1974 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d3b5ea1 c.69.1.14 (A:7-215) Uncharacterized protein Mll8374 {Mesorhizobium loti [TaxId: 381]} | Back information, alignment and structure |
|---|
| >d1fj2a_ c.69.1.14 (A:) Acyl protein thioesterase 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2h7xa1 c.69.1.22 (A:9-291) Picromycin polyketide synthase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1cexa_ c.69.1.30 (A:) Cutinase {Fungus (Fusarium solani), subsp. pisi [TaxId: 169388]} | Back information, alignment and structure |
|---|
| >d1va4a_ c.69.1.12 (A:) Arylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d1tqha_ c.69.1.29 (A:) Carboxylesterase Est {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1a88a_ c.69.1.12 (A:) Chloroperoxidase L {Streptomyces lividans [TaxId: 1916]} | Back information, alignment and structure |
|---|
| >d1thta_ c.69.1.13 (A:) Myristoyl-ACP-specific thioesterase {Vibrio harveyi [TaxId: 669]} | Back information, alignment and structure |
|---|
| >d1mo2a_ c.69.1.22 (A:) Erythromycin polyketide synthase {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1tiba_ c.69.1.17 (A:) Triacylglycerol lipase {Thermomyces lanuginosus, formerly Humicola lanuginosa [TaxId: 5541]} | Back information, alignment and structure |
|---|
| >d1a8sa_ c.69.1.12 (A:) Chloroperoxidase F {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2b61a1 c.69.1.40 (A:2-358) Homoserine O-acetyltransferase {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1auoa_ c.69.1.14 (A:) Carboxylesterase {Pseudomonas fluorescens [TaxId: 294]} | Back information, alignment and structure |
|---|
| >d2pl5a1 c.69.1.40 (A:5-366) Homoserine O-acetyltransferase {Leptospira interrogans [TaxId: 173]} | Back information, alignment and structure |
|---|
| >d2h1ia1 c.69.1.14 (A:1-202) Carboxylesterase {Bacillus cereus [TaxId: 1396]} | Back information, alignment and structure |
|---|
| >d1uwca_ c.69.1.17 (A:) Feruloyl esterase A {Aspergillus niger [TaxId: 5061]} | Back information, alignment and structure |
|---|
| >d2vata1 c.69.1.40 (A:7-382) Acetyl-CoA:deacetylcephalosporin C acetyltransferase CefG {Acremonium chrysogenum [TaxId: 5044]} | Back information, alignment and structure |
|---|
| >d1bu8a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2r8ba1 c.69.1.14 (A:44-246) Uncharacterized protein Atu2452 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d2fuka1 c.69.1.36 (A:3-220) XC6422 protein {Xanthomonas campestris [TaxId: 339]} | Back information, alignment and structure |
|---|
| >d2jbwa1 c.69.1.41 (A:8-367) 2,6-dihydropseudooxynicotine hydrolase {Arthrobacter nicotinovorans [TaxId: 29320]} | Back information, alignment and structure |
|---|
| >d1rp1a2 c.69.1.19 (A:1-336) Pancreatic lipase, N-terminal domain {Dog (Canis familiaris) [TaxId: 9615]} | Back information, alignment and structure |
|---|
| >d1wb4a1 c.69.1.2 (A:803-1075) Feruloyl esterase domain of the cellulosomal xylanase y {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1jjfa_ c.69.1.2 (A:) Feruloyl esterase domain of the cellulosomal xylanase z {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1tiaa_ c.69.1.17 (A:) Triacylglycerol lipase {Penicillium camembertii [TaxId: 5075]} | Back information, alignment and structure |
|---|
| >d1lgya_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizopus niveus [TaxId: 4844]} | Back information, alignment and structure |
|---|
| >d1g66a_ c.69.1.30 (A:) Acetylxylan esterase {Penicillium purpurogenum [TaxId: 28575]} | Back information, alignment and structure |
|---|
| >d1qoza_ c.69.1.30 (A:) Acetylxylan esterase {Trichoderma reesei [TaxId: 51453]} | Back information, alignment and structure |
|---|
| >d3tgla_ c.69.1.17 (A:) Triacylglycerol lipase {Rhizomucor miehei [TaxId: 4839]} | Back information, alignment and structure |
|---|
| >d1xfda2 c.69.1.24 (A:592-849) Dipeptidyl aminopeptidase-like protein 6, DPP6, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wm1a_ c.69.1.7 (A:) Proline aminopeptidase {Serratia marcescens [TaxId: 615]} | Back information, alignment and structure |
|---|
| >d3c8da2 c.69.1.2 (A:151-396) Enterochelin esterase, catalytic domain {Shigella flexneri 2a str. 2457T [TaxId: 198215]} | Back information, alignment and structure |
|---|
| >d1sfra_ c.69.1.3 (A:) Antigen 85a {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1dqza_ c.69.1.3 (A:) Antigen 85c {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1ufoa_ c.69.1.27 (A:) Hypothetical protein TT1662 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|