Citrus Sinensis ID: 025070

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------26

MASISSSSSLILSQQNLIFSKTHFTFQSRQPILQIRFPKLSYSLHNLKTASIEDSTTRLFAVAEETASSSSSSVDTPSEFARRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKPLVQVDLSLLQAEDSNFVDSPYKVYVGNLAKTVTSEMLKKCFSEKGQVLSAKVLRVPGTSKSSGFGFVTFSSEEDAEAAISSLNNSLLEGQRIRVNKA

cccccccccccccccccccccccccccccccccccccccccHHHHHccccccccccccccccccccccccccccccccccccEEEEccccccccHHHHHHHHHccccEEEEEEEEEccccccccEEEEEcccHHHHHHHHHHHcccECccCEEEEEcccccccccHHHHHHHHcccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEcccHHHHHHHHHHccccccccCEEEEECc

**********ILSQQNLIFSKTHFTFQSRQPILQIRFPKLSYSLHNLKTASIE****RLF*********************RRVYIGNIPRNIDNDELTKIVQEHGAVEKAEVIYDKYTGRSRRFAFVMMKTVEDANAVIEKLNGTEIGGREIKVNITEKPLVQVDLSLLQAEDSNFVDSPYKVYVGNLAKTVTSEMLKKCFSEKGQVLSAKVLRVPGTSKSSGFGFVTFSSEEDAEAAISSLNNSLLEGQRIRVNKA

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
30S ribosomal protein 2, chloroplastic	May have a role in the recruitment of stored chloroplast mRNAs for active protein synthesis.	probable	P82277

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 81-258
View the alignment between query and template
View the model in PyMOL

Template: 2YH0, chain A
Confidence level:very confident
Coverage over the Query: 13-162
View the alignment between query and template
View the model in PyMOL