BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025081
(258 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|2DH4|A Chain A, Geranylgeranyl Pyrophosphate Synthase
pdb|2DH4|B Chain B, Geranylgeranyl Pyrophosphate Synthase
pdb|2E8T|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium, Fspp And Ipp
pdb|2E8T|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium, Fspp And Ipp
pdb|2E8U|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Ipp (P21)
pdb|2E8U|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Ipp (P21)
pdb|2E8V|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Product Ggpp (P21)
pdb|2E8V|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Product Ggpp (P21)
pdb|2E8W|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Ipp
pdb|2E8W|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Ipp
pdb|2E8X|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Gpp
pdb|2E8X|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Gpp
pdb|2E90|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium, Pyrophosphate And Fpp
pdb|2E90|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium, Pyrophosphate And Fpp
pdb|2E91|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-91
pdb|2E91|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-91
pdb|2E92|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-261
pdb|2E92|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-261
pdb|2E93|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-629
pdb|2E93|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-629
pdb|2E94|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-364
pdb|2E94|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-364
pdb|2E95|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-675
pdb|2E95|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-675
pdb|2Z7H|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Inhibitor Bph-210
pdb|2Z7H|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Inhibitor Bph-210
pdb|2Z4V|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Ggpp (Inhibitory Site)
pdb|2Z4V|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Ggpp (Inhibitory Site)
pdb|2Z4W|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-749
pdb|2Z4W|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-749
pdb|2Z4X|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-252 (P21)
pdb|2Z4X|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-252 (P21)
pdb|2Z4Y|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-252
pdb|2Z4Y|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-252
pdb|2Z4Z|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-Sc01
pdb|2Z4Z|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-Sc01
pdb|2Z50|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-28
pdb|2Z50|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-28
pdb|2Z52|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-23
pdb|2Z52|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium And Bph-23
pdb|2Z78|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-806
pdb|2Z78|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-806
pdb|2Z7I|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Inhibitor Bph-742
pdb|2Z7I|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Inhibitor Bph-742
pdb|2ZEU|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-715
pdb|2ZEU|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Bph-715
pdb|2ZEV|A Chain A, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium, Ipp And Bph-715
pdb|2ZEV|B Chain B, S. Cerevisiae Geranylgeranyl Pyrophosphate Synthase In
Complex With Magnesium, Ipp And Bph-715
Length = 340
Score = 30.4 bits (67), Expect = 0.99, Method: Compositional matrix adjust.
Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 8/67 (11%)
Query: 131 RIQIDLLESYKILRCSCCSRSGHSLLPSLHDTSILYNLAQEHGDHINLHDWYQSFKSKVC 190
R+ + L+E+ S S GHSL+P ++ I+Y Q D++NL D+ S +
Sbjct: 180 RLTLRLMEA-----LSPSSHHGHSLVPFINLLGIIY---QIRDDYLNLKDFQMSSEKGFA 231
Query: 191 SSRSKGK 197
++GK
Sbjct: 232 EDITEGK 238
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.320 0.133 0.392
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,924,127
Number of Sequences: 62578
Number of extensions: 252505
Number of successful extensions: 586
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 586
Number of HSP's gapped (non-prelim): 1
length of query: 258
length of database: 14,973,337
effective HSP length: 97
effective length of query: 161
effective length of database: 8,903,271
effective search space: 1433426631
effective search space used: 1433426631
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)