BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025085
(258 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3BRW|A Chain A, Structure Of The Rap-Rapgap Complex
pdb|3BRW|B Chain B, Structure Of The Rap-Rapgap Complex
pdb|3BRW|C Chain C, Structure Of The Rap-Rapgap Complex
Length = 341
Score = 27.3 bits (59), Expect = 8.9, Method: Compositional matrix adjust.
Identities = 12/51 (23%), Positives = 29/51 (56%), Gaps = 6/51 (11%)
Query: 189 LKFGEIYERIESAKQKQMMELEKERLEFIKDVECERMNMFMGAQLEIQKSK 239
KFG IY+++ + ++++ +E F++ +E F+G ++++Q K
Sbjct: 119 FKFGVIYQKLGATSEEELFSTNEESPAFVEFLE------FLGQKVKLQDFK 163
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.316 0.130 0.374
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,977,110
Number of Sequences: 62578
Number of extensions: 192246
Number of successful extensions: 370
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 370
Number of HSP's gapped (non-prelim): 1
length of query: 258
length of database: 14,973,337
effective HSP length: 97
effective length of query: 161
effective length of database: 8,903,271
effective search space: 1433426631
effective search space used: 1433426631
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)