Citrus Sinensis ID: 025104
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| 225444936 | 413 | PREDICTED: PCI domain-containing protein | 1.0 | 0.624 | 0.922 | 1e-138 | |
| 255546087 | 412 | PCI domain-containing protein, putative | 1.0 | 0.626 | 0.910 | 1e-136 | |
| 224088756 | 413 | predicted protein [Populus trichocarpa] | 1.0 | 0.624 | 0.903 | 1e-134 | |
| 449446588 | 413 | PREDICTED: PCI domain-containing protein | 1.0 | 0.624 | 0.864 | 1e-130 | |
| 297832206 | 414 | hypothetical protein ARALYDRAFT_480516 [ | 1.0 | 0.623 | 0.856 | 1e-127 | |
| 356561961 | 413 | PREDICTED: PCI domain-containing protein | 1.0 | 0.624 | 0.910 | 1e-127 | |
| 356547787 | 410 | PREDICTED: PCI domain-containing protein | 1.0 | 0.629 | 0.910 | 1e-126 | |
| 30680717 | 413 | proteasome-like protein [Arabidopsis tha | 1.0 | 0.624 | 0.844 | 1e-126 | |
| 212720664 | 409 | uncharacterized protein LOC100193209 [Ze | 0.992 | 0.625 | 0.812 | 1e-122 | |
| 125605557 | 409 | hypothetical protein OsJ_29216 [Oryza sa | 0.992 | 0.625 | 0.808 | 1e-121 |
| >gi|225444936|ref|XP_002282302.1| PREDICTED: PCI domain-containing protein 2 [Vitis vinifera] gi|297738675|emb|CBI27920.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 497 bits (1280), Expect = e-138, Method: Compositional matrix adjust.
Identities = 238/258 (92%), Positives = 252/258 (97%)
Query: 1 MKVFGVLAGKGSKRVGALYLTCQLFKIYFKLGTVHLCRSVIRSIETARIFDFEEFPKRDK 60
MKVFGVLAGKG KRVGALY+TCQLFKIYFKLGTVHLCRSVIRSIETARIFDFEEFP RDK
Sbjct: 156 MKVFGVLAGKGPKRVGALYVTCQLFKIYFKLGTVHLCRSVIRSIETARIFDFEEFPIRDK 215
Query: 61 VTYMYYTGRLEVFNENFPAADQKLSYALINCNPQSEANIRMILKYLIPVKLSIGILPKDW 120
VTYMYYTGRLEVFNENFPAADQKLSYAL++CNP EANIRMILKYLIPVKLSIGILPK+W
Sbjct: 216 VTYMYYTGRLEVFNENFPAADQKLSYALMHCNPHREANIRMILKYLIPVKLSIGILPKNW 275
Query: 121 LLEKYNLVEYSNIVQALRRGDLRLLRHALEEHEDQFLRSGVYLVLEKLELQVYQRLFKKI 180
LLEKYNL+EYSNIVQAL+RGDLRLLRHAL+EHED+FLRSGVYLVLEKLELQVYQRL KKI
Sbjct: 276 LLEKYNLIEYSNIVQALKRGDLRLLRHALQEHEDRFLRSGVYLVLEKLELQVYQRLVKKI 335
Query: 181 YIIQKQKDPSKAHQMKLDVIVKALKWLEMDMDVDEVECIVAILIHKNLVKGYFAHKSKVV 240
Y IQKQKDPSKAHQ+KL+VIVKALKWLEMDMDVDEVECI++ILI+KNL+KGYFAHKSKVV
Sbjct: 336 YFIQKQKDPSKAHQLKLEVIVKALKWLEMDMDVDEVECIMSILIYKNLMKGYFAHKSKVV 395
Query: 241 VLSKQDPFPKLNGKPVNS 258
VLSKQDPFPKLNGKPVNS
Sbjct: 396 VLSKQDPFPKLNGKPVNS 413
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255546087|ref|XP_002514103.1| PCI domain-containing protein, putative [Ricinus communis] gi|223546559|gb|EEF48057.1| PCI domain-containing protein, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224088756|ref|XP_002308527.1| predicted protein [Populus trichocarpa] gi|222854503|gb|EEE92050.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449446588|ref|XP_004141053.1| PREDICTED: PCI domain-containing protein 2-like [Cucumis sativus] gi|449488021|ref|XP_004157917.1| PREDICTED: PCI domain-containing protein 2-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|297832206|ref|XP_002883985.1| hypothetical protein ARALYDRAFT_480516 [Arabidopsis lyrata subsp. lyrata] gi|297329825|gb|EFH60244.1| hypothetical protein ARALYDRAFT_480516 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|356561961|ref|XP_003549244.1| PREDICTED: PCI domain-containing protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|356547787|ref|XP_003542290.1| PREDICTED: PCI domain-containing protein 2-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|30680717|ref|NP_179546.2| proteasome-like protein [Arabidopsis thaliana] gi|26452802|dbj|BAC43481.1| unknown protein [Arabidopsis thaliana] gi|330251801|gb|AEC06895.1| proteasome-like protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|212720664|ref|NP_001131834.1| uncharacterized protein LOC100193209 [Zea mays] gi|194692672|gb|ACF80420.1| unknown [Zea mays] gi|414885294|tpg|DAA61308.1| TPA: hypothetical protein ZEAMMB73_565062 [Zea mays] | Back alignment and taxonomy information |
|---|
| >gi|125605557|gb|EAZ44593.1| hypothetical protein OsJ_29216 [Oryza sativa Japonica Group] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 258 | ||||||
| TAIR|locus:2050414 | 413 | EER5 "ENHANCED ETHYLENE RESPON | 1.0 | 0.624 | 0.802 | 3.9e-108 | |
| RGD|1307041 | 400 | Pcid2 "PCI domain containing 2 | 0.918 | 0.592 | 0.412 | 9.5e-50 | |
| UNIPROTKB|F1NEE3 | 403 | PCID2 "Uncharacterized protein | 0.918 | 0.588 | 0.408 | 2e-49 | |
| UNIPROTKB|Q5JVF3 | 399 | PCID2 "PCI domain-containing p | 0.918 | 0.593 | 0.408 | 4.1e-49 | |
| MGI|MGI:2443003 | 399 | Pcid2 "PCI domain containing 2 | 0.918 | 0.593 | 0.404 | 5.2e-49 | |
| UNIPROTKB|F1MWG9 | 408 | PCID2 "PCI domain-containing p | 0.941 | 0.595 | 0.388 | 4.2e-47 | |
| UNIPROTKB|Q2TBN6 | 408 | PCID2 "PCI domain-containing p | 0.941 | 0.595 | 0.388 | 4.2e-47 | |
| UNIPROTKB|F1RN42 | 405 | PCID2 "Uncharacterized protein | 0.918 | 0.585 | 0.376 | 1.8e-46 | |
| ZFIN|ZDB-GENE-041114-79 | 399 | pcid2 "PCI domain containing 2 | 0.903 | 0.583 | 0.380 | 2.1e-45 | |
| FB|FBgn0036184 | 395 | PCID2 "PCI domain-containing p | 0.930 | 0.607 | 0.385 | 4.4e-45 |
| TAIR|locus:2050414 EER5 "ENHANCED ETHYLENE RESPONSE 5" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1069 (381.4 bits), Expect = 3.9e-108, P = 3.9e-108
Identities = 207/258 (80%), Positives = 227/258 (87%)
Query: 1 MKVFGVLAGKGSKRVGALYLTCQLFKIYFKLGTVHLCRSVIRSIETARIFDFEEFPKRDK 60
MKVFGVLAGKG KRVGALY+TCQLFK YFKLGTV+LCRSVIRSIETARIFDFEEFP+RDK
Sbjct: 156 MKVFGVLAGKGPKRVGALYVTCQLFKTYFKLGTVNLCRSVIRSIETARIFDFEEFPRRDK 215
Query: 61 VTYMYYTGRLEVFNENFPAADQKLSYALINCNPQSEANIRMILKYLIPVKLSIGILPKDW 120
VTYMYYTGRLEVFNENFPAAD KLSYAL NCNP+ E NIRMILKYL+PVKLS+GI+PKD
Sbjct: 216 VTYMYYTGRLEVFNENFPAADTKLSYALQNCNPKRERNIRMILKYLVPVKLSLGIIPKDE 275
Query: 121 LLEKYNLVEYSNIVQALRRGDXXXXXXXXXXXXDQFLRSGVYLVLEKLELQVYQRLFKKI 180
LL YNL EY+ IVQALR+GD D+FLRSGVYLVLEKLELQVYQRL KKI
Sbjct: 276 LLRNYNLHEYTKIVQALRKGDLRLLRHALQEHEDRFLRSGVYLVLEKLELQVYQRLMKKI 335
Query: 181 YIIQKQKDPSKAHQMKLDVIVKALKWLEMDMDVDEVECIVAILIHKNLVKGYFAHKSKVV 240
YI QK DP++AHQ+KL+ I KAL+WL+MDMD+DEVECI+ ILI+KNLVKGY AHKSKVV
Sbjct: 336 YINQKLSDPARAHQLKLEGIAKALRWLDMDMDLDEVECIMTILIYKNLVKGYLAHKSKVV 395
Query: 241 VLSKQDPFPKLNGKPVNS 258
VLSKQDPFPKLNGKPV+S
Sbjct: 396 VLSKQDPFPKLNGKPVSS 413
|
|
| RGD|1307041 Pcid2 "PCI domain containing 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NEE3 PCID2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5JVF3 PCID2 "PCI domain-containing protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2443003 Pcid2 "PCI domain containing 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MWG9 PCID2 "PCI domain-containing protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2TBN6 PCID2 "PCI domain-containing protein 2" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RN42 PCID2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041114-79 pcid2 "PCI domain containing 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0036184 PCID2 "PCI domain-containing protein 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| estExt_fgenesh4_pm.C_LG_VI0641 | hypothetical protein (413 aa) | |||||||
(Populus trichocarpa) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| COG5600 | 413 | COG5600, COG5600, Transcription-associated recombi | 9e-40 | |
| pfam01399 | 100 | pfam01399, PCI, PCI domain | 4e-10 |
| >gnl|CDD|227887 COG5600, COG5600, Transcription-associated recombination protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
Score = 141 bits (358), Expect = 9e-40
Identities = 82/245 (33%), Positives = 126/245 (51%), Gaps = 10/245 (4%)
Query: 12 SKRVGALYLTCQLFKIYFKLGTVHLCRSVIRSIETARIFDFEEFPKRDKVTYMYYTGRLE 71
SK+VG Y+ LF+IY +LG LC + +++ + + D E+ K V + YY G
Sbjct: 171 SKKVGLYYIANLLFQIYLRLGRFKLCENFLKASKEVSMPDISEYQKSQVVVFHYYLGIYY 230
Query: 72 VFNENFPAADQKLSYALINCNPQSEANIRMILKYLIPVKLSIG-ILPKDWLLEKYNLVE- 129
+ NENF A L+ A + C N + IL Y IP L + P LLE++
Sbjct: 231 LLNENFHEAFLHLNEAFLQCPWLITRNRKRILPYYIPTSLLVNKFPPTKDLLERFKRCSV 290
Query: 130 YSNIVQALRRGDLRLLRHALEEHEDQFLRSGVYLVL-EKLELQVYQRLFKKIYIIQKQKD 188
YS +V+A+R G++ AL +E +F + G+YL L L ++ LF+KI+ +
Sbjct: 291 YSPLVKAVRSGNIEDFDLALSRNERKFAKRGLYLTLLAHYPLVCFRNLFRKIWRLHG--- 347
Query: 189 PSKAHQMKLDV--IVKALKWLEMDMDVDEVECIVAILIHKNLVKGYFAHKSKVVVLSKQD 246
K ++ L + IV L ++ EVECI+ LI L++GY +H + VV SK+D
Sbjct: 348 --KQSRLPLSILLIVLQLSAIDNFHSFKEVECILVTLIGLGLLRGYISHSRRTVVFSKKD 405
Query: 247 PFPKL 251
PFP
Sbjct: 406 PFPVS 410
|
Length = 413 |
| >gnl|CDD|216479 pfam01399, PCI, PCI domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| KOG2688 | 394 | consensus Transcription-associated recombination p | 100.0 | |
| COG5600 | 413 | Transcription-associated recombination protein [DN | 100.0 | |
| KOG2581 | 493 | consensus 26S proteasome regulatory complex, subun | 100.0 | |
| KOG1464 | 440 | consensus COP9 signalosome, subunit CSN2 [Posttran | 99.81 | |
| PF01399 | 105 | PCI: PCI domain; InterPro: IPR000717 A homology do | 99.7 | |
| KOG2908 | 380 | consensus 26S proteasome regulatory complex, subun | 99.38 | |
| KOG1463 | 411 | consensus 26S proteasome regulatory complex, subun | 99.15 | |
| KOG2582 | 422 | consensus COP9 signalosome, subunit CSN3 [Posttran | 99.08 | |
| COG5159 | 421 | RPN6 26S proteasome regulatory complex component [ | 98.8 | |
| smart00753 | 88 | PAM PCI/PINT associated module. | 98.51 | |
| smart00088 | 88 | PINT motif in proteasome subunits, Int-6, Nip-1 an | 98.51 | |
| KOG1497 | 399 | consensus COP9 signalosome, subunit CSN4 [Posttran | 98.02 | |
| KOG2753 | 378 | consensus Uncharacterized conserved protein, conta | 97.96 | |
| PF10255 | 404 | Paf67: RNA polymerase I-associated factor PAF67; I | 97.66 | |
| KOG0687 | 393 | consensus 26S proteasome regulatory complex, subun | 97.01 | |
| COG5187 | 412 | RPN7 26S proteasome regulatory complex component, | 96.84 | |
| KOG2758 | 432 | consensus Translation initiation factor 3, subunit | 96.66 | |
| KOG1498 | 439 | consensus 26S proteasome regulatory complex, subun | 96.59 | |
| PF07719 | 34 | TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 | 96.49 | |
| KOG0686 | 466 | consensus COP9 signalosome, subunit CSN1 [Posttran | 96.44 | |
| PF13432 | 65 | TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL | 96.16 | |
| PF13371 | 73 | TPR_9: Tetratricopeptide repeat | 95.87 | |
| PF00515 | 34 | TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 | 94.65 | |
| KOG1076 | 843 | consensus Translation initiation factor 3, subunit | 94.4 | |
| PF12895 | 84 | Apc3: Anaphase-promoting complex, cyclosome, subun | 93.63 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 93.49 | |
| PF13424 | 78 | TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 | 93.24 | |
| COG5071 | 439 | RPN5 26S proteasome regulatory complex component [ | 92.94 | |
| TIGR02552 | 135 | LcrH_SycD type III secretion low calcium response | 92.8 | |
| PF13181 | 34 | TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ | 92.36 | |
| PF13174 | 33 | TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ | 92.14 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 91.06 | |
| PF09012 | 69 | FeoC: FeoC like transcriptional regulator; InterPr | 90.84 | |
| PRK15359 | 144 | type III secretion system chaperone protein SscB; | 90.73 | |
| PF14938 | 282 | SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 | 90.04 | |
| KOG2072 | 988 | consensus Translation initiation factor 3, subunit | 89.91 | |
| PF13414 | 69 | TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A | 89.39 | |
| cd00189 | 100 | TPR Tetratricopeptide repeat domain; typically con | 88.59 | |
| PF13428 | 44 | TPR_14: Tetratricopeptide repeat | 87.66 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 86.2 | |
| smart00028 | 34 | TPR Tetratricopeptide repeats. Repeats present in | 85.9 | |
| KOG2300 | 629 | consensus Uncharacterized conserved protein [Funct | 85.68 | |
| PF04733 | 290 | Coatomer_E: Coatomer epsilon subunit; InterPro: IP | 85.43 | |
| PF13176 | 36 | TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ | 84.06 | |
| PF14559 | 68 | TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN | 83.42 | |
| PF09976 | 145 | TPR_21: Tetratricopeptide repeat; InterPro: IPR018 | 82.57 | |
| PF08631 | 278 | SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: | 81.01 | |
| TIGR02795 | 119 | tol_pal_ybgF tol-pal system protein YbgF. Members | 80.93 |
| >KOG2688 consensus Transcription-associated recombination protein - Thp1p [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.4e-59 Score=425.81 Aligned_cols=247 Identities=42% Similarity=0.712 Sum_probs=237.3
Q ss_pred CcccccccCC------CchhHHHHHHHHHHHHHHHhcCChhhHHHHHHHhhccCCCCCCCCCccchhhhhhhhhHHhhhh
Q 025104 1 MKVFGVLAGK------GSKRVGALYLTCQLFKIYFKLGTVHLCRSVIRSIETARIFDFEEFPKRDKVTYMYYTGRLEVFN 74 (258)
Q Consensus 1 ~~~~~~~~~d------~~Kk~~~~~~~n~l~kiyf~l~~~~~~~~l~~~i~~~~~p~~~~~~~~~~v~y~YY~G~~~~~~ 74 (258)
|++|+.|.+| ++|++|+++++|++|+|||+++++++|+++++++++. .+..+.++.+|.++|+||.|+++|++
T Consensus 140 ~~~f~~cl~d~~~~~~~~kk~~~~~i~n~lf~Iyfri~~~~L~k~l~ra~~~~-~~~~~~~~l~~~v~y~YylGr~a~~~ 218 (394)
T KOG2688|consen 140 SRLFSSCLSDRRADLEESKKVAMLYIVNQLFQIYFRIEKLLLCKNLIRAFDQS-GSDISDFPLAQLVVYHYYLGRYAMFE 218 (394)
T ss_pred HHHHHHHhCccccccccchhhHHHHHHHHHHHHHHHHhhHHHhHHHHHHhhcc-ccchhhcccccceeeeeeeeeehhhh
Confidence 4689999999 3899999999999999999999999999999999986 47788899999999999999999999
Q ss_pred cChHHHHHHHHHHHHhcCccChHHHHHHHHHHHHHHhhcCCCCChhhhhhccccccHHHHHHHHhCCHHHHHHHHHHcHH
Q 025104 75 ENFPAADQKLSYALINCNPQSEANIRMILKYLIPVKLSIGILPKDWLLEKYNLVEYSNIVQALRRGDLRLLRHALEEHED 154 (258)
Q Consensus 75 ~~~~~A~~~L~~A~~~c~~~~~~~~~~IL~~LIp~~Ll~G~~P~~~ll~~~~l~~y~~L~~av~~Gdl~~f~~~l~~~~~ 154 (258)
.||.+|..+|.+||.+||.....|+++|++||||++|++|++|..+++++|+++.|.++++||+.||+..|+.++++||.
T Consensus 219 ~d~~~A~~~L~~af~~cp~~~~~n~~~iliylip~~~llg~~Pt~~lL~~~~~~~~~~lv~aVr~Gnl~~f~~al~~~E~ 298 (394)
T KOG2688|consen 219 SDFLNAFLQLNEAFRLCPDLLLKNKRLILIYLIPTGLLLGRIPTKELLDFYTLDKYSPLVQAVRSGNLRLFDLALADNER 298 (394)
T ss_pred hhHHHHHHHHHHHHHhCcHHHHhhhhhHHHHHhHHHHHhccCcchhhHhHhhHHhHHHHHHHHHhccHHHHHHHHhhhHH
Confidence 99999999999999999999999999999999999999999999999999999899999999999999999999999999
Q ss_pred HHHHhcHHHHHHhhHHHHHHHHHHHHHHHhhcCCCCCCccccHHHHHHHHHhcc-CCCCHHHHHHHHHHHHHcCcceEEe
Q 025104 155 QFLRSGVYLVLEKLELQVYQRLFKKIYIIQKQKDPSKAHQMKLDVIVKALKWLE-MDMDVDEVECIVAILIHKNLVKGYF 233 (258)
Q Consensus 155 ~f~~~glylll~~l~~~v~r~L~kkv~~~~~~~~~~~~~~i~l~~i~~al~~~~-~~~~~~evE~ila~LI~~G~IkGyI 233 (258)
+|++.|+|+++++++.+|||||+||||.++ ++.+++|++.|..|++.++ .+.+.||+||++|+||++|+|||||
T Consensus 299 ~f~~~gi~l~l~~l~lv~yrnL~kkv~~~~-----~~~~~lpls~~~~al~~~~~~~~~~deveciLa~lI~~G~ikgYi 373 (394)
T KOG2688|consen 299 FFIRSGIYLTLEKLPLVVYRNLFKKVIQLW-----GKTSQLPLSRFLTALQFSGVTDVDLDEVECILANLIDLGRIKGYI 373 (394)
T ss_pred HHHHhccHHHhhhhhHHHHHHHHHHHHHHh-----CCCCCCCHHHHHHHHhhcCCCCCchhhHHHHHHhhhhhccccchh
Confidence 999999999999999999999999999998 4679999999999999987 5689999999999999999999999
Q ss_pred ecCceEEEEecCCCCCCCCC
Q 025104 234 AHKSKVVVLSKQDPFPKLNG 253 (258)
Q Consensus 234 ~~~~~~lVlsk~~pFP~~~~ 253 (258)
||+++++|+||++|||.++.
T Consensus 374 sh~~~~~V~sK~~pfp~~v~ 393 (394)
T KOG2688|consen 374 SHQLQTLVFSKKDPFPHLVL 393 (394)
T ss_pred chhhheEEEecCCCCCCCCC
Confidence 99999999999999999875
|
|
| >COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >KOG2581 consensus 26S proteasome regulatory complex, subunit RPN3/PSMD3 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1464 consensus COP9 signalosome, subunit CSN2 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins | Back alignment and domain information |
|---|
| >KOG2908 consensus 26S proteasome regulatory complex, subunit RPN9/PSMD13 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1463 consensus 26S proteasome regulatory complex, subunit RPN6/PSMD11 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2582 consensus COP9 signalosome, subunit CSN3 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >smart00753 PAM PCI/PINT associated module | Back alignment and domain information |
|---|
| >smart00088 PINT motif in proteasome subunits, Int-6, Nip-1 and TRIP-15 | Back alignment and domain information |
|---|
| >KOG1497 consensus COP9 signalosome, subunit CSN4 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2753 consensus Uncharacterized conserved protein, contains PCI domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] | Back alignment and domain information |
|---|
| >KOG0687 consensus 26S proteasome regulatory complex, subunit RPN7/PSMD6 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >COG5187 RPN7 26S proteasome regulatory complex component, contains PCI domain [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2758 consensus Translation initiation factor 3, subunit e (eIF-3e) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >KOG1498 consensus 26S proteasome regulatory complex, subunit RPN5/PSMD12 [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG0686 consensus COP9 signalosome, subunit CSN1 [Posttranslational modification, protein turnover, chaperones; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B | Back alignment and domain information |
|---|
| >PF13371 TPR_9: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] | Back alignment and domain information |
|---|
| >KOG1076 consensus Translation initiation factor 3, subunit c (eIF-3c) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H | Back alignment and domain information |
|---|
| >COG5071 RPN5 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD | Back alignment and domain information |
|---|
| >PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A | Back alignment and domain information |
|---|
| >PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF09012 FeoC: FeoC like transcriptional regulator; InterPro: IPR015102 This entry contains several transcriptional regulators, including FeoC, which contain a HTH motif | Back alignment and domain information |
|---|
| >PRK15359 type III secretion system chaperone protein SscB; Provisional | Back alignment and domain information |
|---|
| >PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A | Back alignment and domain information |
|---|
| >KOG2072 consensus Translation initiation factor 3, subunit a (eIF-3a) [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A | Back alignment and domain information |
|---|
| >cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C | Back alignment and domain information |
|---|
| >PF13428 TPR_14: Tetratricopeptide repeat | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
| >smart00028 TPR Tetratricopeptide repeats | Back alignment and domain information |
|---|
| >KOG2300 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment | Back alignment and domain information |
|---|
| >PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A | Back alignment and domain information |
|---|
| >PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A | Back alignment and domain information |
|---|
| >PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function | Back alignment and domain information |
|---|
| >PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis [] | Back alignment and domain information |
|---|
| >TIGR02795 tol_pal_ybgF tol-pal system protein YbgF | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 258 | ||||
| 3t5x_A | 203 | Pcid2:dss1 Structure Length = 203 | 2e-40 | ||
| 3t5v_B | 455 | Sac3:thp1:sem1 Complex Length = 455 | 1e-04 |
| >pdb|3T5X|A Chain A, Pcid2:dss1 Structure Length = 203 | Back alignment and structure |
|
| >pdb|3T5V|B Chain B, Sac3:thp1:sem1 Complex Length = 455 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 258 | |||
| 3t5v_B | 455 | Nuclear mRNA export protein THP1; PCI, mRNA nuclea | 7e-72 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 4e-67 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-05 |
| >3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Length = 455 | Back alignment and structure |
|---|
Score = 226 bits (576), Expect = 7e-72
Identities = 52/270 (19%), Positives = 106/270 (39%), Gaps = 30/270 (11%)
Query: 10 KGSKRVGALYLTCQLFKIYFKLGTVHLCRSVIRSIETARIF-DFEEFPKRDKVTYMYYTG 68
K+ LYL +L IYF++ + LC ++ ++ + + F E+ ++ Y Y G
Sbjct: 168 IPGKQRILLYLVNKLNNIYFRIESPQLCSNIFKNFQPKSMLAHFNEYQLDQQIEYRYLLG 227
Query: 69 RLEVFNENFPAADQKLSYAL------INCNPQSEANIRMILKYLIPVKLSIGILPKDWLL 122
R + N A + + A N N IL Y+IP L +G + K L
Sbjct: 228 RYYLLNSQVHNAFVQFNEAFQSLLNLPLTNQAITRNGTRILNYMIPTGLILGKMVKWGPL 287
Query: 123 E----KYNLVEYSNIVQALRRGDLRLLRHALEEHEDQFLRSGVYLVL-EKLELQVYQRLF 177
+ + +S + + +R G+++ + L ++E + +VL EKL + Y+ L
Sbjct: 288 RPFLSQETIDNWSVLYKHVRYGNIQGVSLWLRQNERHLCARQLLIVLLEKLPMVTYRNLI 347
Query: 178 KKIYIIQKQKDPSKAHQMKLDVIVKALK----------------WLEMDMDVDEVECIVA 221
K + +++ +I + L+ VE ++
Sbjct: 348 KTVIKSWTT--EWGQNKLPYSLIERVLQLSIGPTFEDPGAQEITIYNGIHSPKNVENVLV 405
Query: 222 ILIHKNLVKGYFAHKSKVVVLSKQDPFPKL 251
LI+ L++ + ++ V+ K ++
Sbjct: 406 TLINLGLLRANCFPQLQLCVVKKTTMIQEI 435
|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| 3t5v_B | 455 | Nuclear mRNA export protein THP1; PCI, mRNA nuclea | 100.0 | |
| 3t5x_A | 203 | PCI domain-containing protein 2; PCI, mRNA nuclear | 100.0 | |
| 4b4t_S | 523 | RPN3, 26S proteasome regulatory subunit RPN3; hydr | 100.0 | |
| 3txn_A | 394 | 26S proteasome regulatory complex subunit P42B; PC | 99.83 | |
| 4b4t_O | 393 | 26S proteasome regulatory subunit RPN9; hydrolase, | 99.74 | |
| 4b4t_P | 445 | 26S proteasome regulatory subunit RPN5; hydrolase, | 99.64 | |
| 4b4t_R | 429 | RPN7, 26S proteasome regulatory subunit RPN7; hydr | 99.5 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 99.46 | |
| 4b0z_A | 229 | RPN12, 26S proteasome regulatory subunit RPN12; pr | 98.76 | |
| 3chm_A | 169 | COP9 signalosome complex subunit 7; heat/ARM repea | 98.68 | |
| 1ufm_A | 84 | COP9 complex subunit 4; helix-turn-helix, structur | 98.38 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 94.58 | |
| 3ma5_A | 100 | Tetratricopeptide repeat domain protein; NESG, str | 94.49 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 93.22 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 93.11 | |
| 3k9i_A | 117 | BH0479 protein; putative protein binding protein, | 93.08 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 93.05 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 92.97 | |
| 2kc7_A | 99 | BFR218_protein; tetratricopeptide repeat, all-alph | 92.79 | |
| 3rkv_A | 162 | Putative peptidylprolyl isomerase; structural geno | 92.71 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 92.61 | |
| 2kat_A | 115 | Uncharacterized protein; NESG, structure, structur | 92.59 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 92.57 | |
| 2l6j_A | 111 | TPR repeat-containing protein associated with HSP; | 92.43 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 92.22 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 92.13 | |
| 2xev_A | 129 | YBGF; tetratricopeptide, alpha-helical, metal bind | 92.04 | |
| 1na3_A | 91 | Designed protein CTPR2; de novo protein; HET: IPT; | 91.93 | |
| 4gco_A | 126 | Protein STI-1; structural genomics, PSI-biology, m | 91.63 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 91.2 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 91.18 | |
| 2kck_A | 112 | TPR repeat; tetratricopeptide repeat, structural g | 91.15 | |
| 2xcb_A | 142 | PCRH, regulatory protein PCRH; protein transport, | 91.12 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 91.0 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 90.63 | |
| 2vgx_A | 148 | Chaperone SYCD; alternative dimer assembly, tetrat | 90.34 | |
| 3q49_B | 137 | STIP1 homology and U box-containing protein 1; E3 | 90.24 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 90.16 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 90.16 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 90.14 | |
| 1elw_A | 118 | TPR1-domain of HOP; HOP, TPR-domain, peptide-compl | 90.14 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 90.04 | |
| 2lni_A | 133 | Stress-induced-phosphoprotein 1; structural genomi | 89.99 | |
| 3gyz_A | 151 | Chaperone protein IPGC; asymmetric homodimer, tetr | 89.95 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 89.78 | |
| 3sz7_A | 164 | HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G | 89.72 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 89.69 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 89.64 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 89.58 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 89.25 | |
| 2vyi_A | 131 | SGTA protein; chaperone, TPR repeat, phosphoprotei | 89.08 | |
| 1qqe_A | 292 | Vesicular transport protein SEC17; helix-turn-heli | 89.05 | |
| 3hym_B | 330 | Cell division cycle protein 16 homolog; APC, anaph | 88.9 | |
| 3upv_A | 126 | Heat shock protein STI1; TPR-fold, adaptor protein | 88.85 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 88.78 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 88.73 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 88.52 | |
| 3urz_A | 208 | Uncharacterized protein; tetratricopeptide repeats | 88.44 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 88.37 | |
| 2fo7_A | 136 | Synthetic consensus TPR protein; tetratricopeptide | 87.97 | |
| 1na0_A | 125 | Designed protein CTPR3; de novo protein; HET: IPT; | 87.75 | |
| 1elr_A | 131 | TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp | 87.64 | |
| 2dba_A | 148 | Smooth muscle cell associated protein-1, isoform 2 | 87.56 | |
| 3vtx_A | 184 | MAMA; tetratricopeptide repeats (TPR) containing p | 87.54 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 87.45 | |
| 1hh8_A | 213 | P67PHOX, NCF-2, neutrophil cytosol factor 2; cell | 86.76 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 86.56 | |
| 1ihg_A | 370 | Cyclophilin 40; ppiase immunophilin tetratricopept | 86.43 | |
| 2vq2_A | 225 | PILW, putative fimbrial biogenesis and twitching m | 86.35 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 86.28 | |
| 3as5_A | 186 | MAMA; tetratricopeptide repeats (TPR) containing p | 86.26 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 86.19 | |
| 3u3w_A | 293 | Transcriptional activator PLCR protein; ternary co | 86.07 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 86.02 | |
| 2e2e_A | 177 | Formate-dependent nitrite reductase complex NRFG; | 85.97 | |
| 1a17_A | 166 | Serine/threonine protein phosphatase 5; hydrolase, | 85.96 | |
| 3u4t_A | 272 | TPR repeat-containing protein; structural genomics | 85.91 | |
| 3ro3_A | 164 | PINS homolog, G-protein-signaling modulator 2; asy | 85.85 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 85.67 | |
| 1kt0_A | 457 | FKBP51, 51 kDa FK506-binding protein; FKBP-like pp | 85.66 | |
| 1p5q_A | 336 | FKBP52, FK506-binding protein 4; isomerase; 2.80A | 85.23 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 85.04 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 84.72 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 84.63 | |
| 3uq3_A | 258 | Heat shock protein STI1; HSP90, peptide binding, c | 84.49 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 84.45 | |
| 2q7f_A | 243 | YRRB protein; TPR, protein binding; 2.49A {Bacillu | 84.26 | |
| 2yhc_A | 225 | BAMD, UPF0169 lipoprotein YFIO; essential BAM comp | 84.21 | |
| 4i17_A | 228 | Hypothetical protein; TPR repeats protein, structu | 83.94 | |
| 1hxi_A | 121 | PEX5, peroxisome targeting signal 1 receptor PEX5; | 83.83 | |
| 3ulq_A | 383 | Response regulator aspartate phosphatase F; tetrat | 83.77 | |
| 2ifu_A | 307 | Gamma-SNAP; membrane fusion, snare complex disasse | 83.71 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 83.59 | |
| 2c2l_A | 281 | CHIP, carboxy terminus of HSP70-interacting protei | 83.49 | |
| 2ho1_A | 252 | Type 4 fimbrial biogenesis protein PILF; type IV p | 83.47 | |
| 3ieg_A | 359 | DNAJ homolog subfamily C member 3; TPR motif, chap | 83.44 | |
| 3q15_A | 378 | PSP28, response regulator aspartate phosphatase H; | 83.29 | |
| 3qky_A | 261 | Outer membrane assembly lipoprotein YFIO; membrane | 83.15 | |
| 2qfc_A | 293 | PLCR protein; TPR, HTH, transcription regulation; | 82.91 | |
| 2pl2_A | 217 | Hypothetical conserved protein TTC0263; TPR, prote | 82.71 | |
| 3sf4_A | 406 | G-protein-signaling modulator 2; tetratricopeptide | 82.26 | |
| 3gw4_A | 203 | Uncharacterized protein; structural genomics, PSI- | 82.18 | |
| 4gcn_A | 127 | Protein STI-1; structural genomics, PSI-biology, m | 82.16 | |
| 2fbn_A | 198 | 70 kDa peptidylprolyl isomerase, putative; sulfur | 82.09 | |
| 1xnf_A | 275 | Lipoprotein NLPI; TPR, tetratricopeptide, structur | 81.79 | |
| 4b4t_Q | 434 | 26S proteasome regulatory subunit RPN6; hydrolase, | 81.64 | |
| 3cv0_A | 327 | Peroxisome targeting signal 1 receptor PEX5; TPR m | 81.37 | |
| 1hz4_A | 373 | MALT regulatory protein; two-helix bundles, helix | 81.13 | |
| 1fch_A | 368 | Peroxisomal targeting signal 1 receptor; protein-p | 81.02 | |
| 4ga2_A | 150 | E3 SUMO-protein ligase ranbp2; TPR motif, nuclear | 80.87 | |
| 1wi9_A | 72 | Protein C20ORF116 homolog; helix-turn-helix motif, | 80.75 | |
| 3mv2_B | 310 | Coatomer subunit epsilon; vesicular membrane coat | 80.68 | |
| 2if4_A | 338 | ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, | 80.41 | |
| 2v5f_A | 104 | Prolyl 4-hydroxylase subunit alpha-1; endoplasmic | 80.15 |
| >3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
Probab=100.00 E-value=2.9e-66 Score=485.41 Aligned_cols=249 Identities=22% Similarity=0.385 Sum_probs=230.6
Q ss_pred CcccccccCCC------c---hhHHHHHHHHHHHHHHHhcCChhhHHHHHHHhhccC-CCCCCCCCccchhhhhhhhhHH
Q 025104 1 MKVFGVLAGKG------S---KRVGALYLTCQLFKIYFKLGTVHLCRSVIRSIETAR-IFDFEEFPKRDKVTYMYYTGRL 70 (258)
Q Consensus 1 ~~~~~~~~~d~------~---Kk~~~~~~~n~l~kiyf~l~~~~~~~~l~~~i~~~~-~p~~~~~~~~~~v~y~YY~G~~ 70 (258)
+|+|+.|.+|. | ||+|++|++|++||+|||+|++++|++++++++++. +|+++.+|++|+|+|+||+||+
T Consensus 150 ~k~F~~cl~Dr~~~~~~s~p~kk~~~l~l~n~L~kiYFkl~~~~lckni~k~i~~~~~~p~~~~~p~~q~v~Y~YYlGr~ 229 (455)
T 3t5v_B 150 SRLFNSIKPPRGNASSTNIPGKQRILLYLVNKLNNIYFRIESPQLCSNIFKNFQPKSMLAHFNEYQLDQQIEYRYLLGRY 229 (455)
T ss_dssp HHHHHHCCCC----CCSSCCHHHHHHHHHHHHHHHHHHHSSCCTTHHHHHHTHHHHCCCSCGGGSCHHHHHHHHHHHHHH
T ss_pred HHHHHHhcccCCCcccccccccchhHHHHHHHHHHHHHHcCCHHHHHHHHHHhccCCCCcChhhCCccceEeeeHHHHHH
Confidence 47999999983 3 999999999999999999999999999999999864 4689999999999999999999
Q ss_pred hhhhcChHHHHHHHHHHHHh-cCcc-----ChHHHHHHHHHHHHHHhhcCCCCChhhhhhc---cccc-cHHHHHHHHhC
Q 025104 71 EVFNENFPAADQKLSYALIN-CNPQ-----SEANIRMILKYLIPVKLSIGILPKDWLLEKY---NLVE-YSNIVQALRRG 140 (258)
Q Consensus 71 ~~~~~~~~~A~~~L~~A~~~-c~~~-----~~~~~~~IL~~LIp~~Ll~G~~P~~~ll~~~---~l~~-y~~L~~av~~G 140 (258)
++++++|.+|+++|++||++ ||.+ ..+|+++||+||||++|++|++|++.+++++ ++.+ |.+|++|||+|
T Consensus 230 ~~~~~~y~~A~~~L~~A~~~lcp~~~~~~~~~~n~~~ILkyLIpv~LLlG~~P~~~ll~k~~~~~L~~~y~~L~~AVr~G 309 (455)
T 3t5v_B 230 YLLNSQVHNAFVQFNEAFQSLLNLPLTNQAITRNGTRILNYMIPTGLILGKMVKWGPLRPFLSQETIDNWSVLYKHVRYG 309 (455)
T ss_dssp HHHTTCHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHTTCCBCHHHHGGGSCHHHHHHHHHHHHHHHHT
T ss_pred HHHHccHHHHHHHHHHHHHhcCCccccchhhhhHHHHHHHHHHHHHHHcCCCCCHHHHcccchHHHHHHHHHHHHHHHhC
Confidence 99999999999999999999 9987 4799999999999999999999999999984 5776 99999999999
Q ss_pred CHHHHHHHHHHcHHHHHHhcH-HHHHHhhHHHHHHHHHHHH---HHHhhcCCCCCCccccHHHHHHHHHhccCC------
Q 025104 141 DLRLLRHALEEHEDQFLRSGV-YLVLEKLELQVYQRLFKKI---YIIQKQKDPSKAHQMKLDVIVKALKWLEMD------ 210 (258)
Q Consensus 141 dl~~f~~~l~~~~~~f~~~gl-ylll~~l~~~v~r~L~kkv---~~~~~~~~~~~~~~i~l~~i~~al~~~~~~------ 210 (258)
|+.+|++++++|+++|+++|+ |++++|+|.+|||||+|+| |... .+.++||+++|+.++++++.+
T Consensus 310 dl~~F~~~L~~~~~~f~~~gily~LlerLr~~v~RnLirkv~~~~~~~-----~~~srI~l~~i~~aL~~~~~~~~~~~~ 384 (455)
T 3t5v_B 310 NIQGVSLWLRQNERHLCARQLLIVLLEKLPMVTYRNLIKTVIKSWTTE-----WGQNKLPYSLIERVLQLSIGPTFEDPG 384 (455)
T ss_dssp CHHHHHHHHHHTHHHHHHTTCHHHHHHHHHHHHHHHHHHHHHHHHTTT-----TCCCEEEHHHHHHHHHHHHCCCTTSTT
T ss_pred CHHHHHHHHHHhHHHHHHcCCHHHHHHHHHHHHHHHHHHHHHHHHHhc-----CCCCeeeHHHHHHHHhhccCccccccc
Confidence 999999999999999999999 8999999999999999999 5442 346999999999999986432
Q ss_pred ----------CCHHHHHHHHHHHHHcCcceEEeecCceEEEEecC----CCCCCCCCC
Q 025104 211 ----------MDVDEVECIVAILIHKNLVKGYFAHKSKVVVLSKQ----DPFPKLNGK 254 (258)
Q Consensus 211 ----------~~~~evE~ila~LI~~G~IkGyI~~~~~~lVlsk~----~pFP~~~~~ 254 (258)
.|+||||||||+||.+|+|||||+|+++++|+||+ +|||+++++
T Consensus 385 ~~~~~~~~~~~~~devEcIlA~LI~~G~IkGyIsh~~~~lVlSK~~~~~~pFP~l~~~ 442 (455)
T 3t5v_B 385 AQEITIYNGIHSPKNVENVLVTLINLGLLRANCFPQLQLCVVKKTTMIQEIVPPVNER 442 (455)
T ss_dssp CCCCCTTTSSCCSSCHHHHHHHHHHHTSCCEEEETTTTEEEECCCSCGGGTSCCHHHH
T ss_pred cccccccccCCCHHHHHHHHHHHHHcCCeEEEEecCCCEEEECCCCCCCCCCCChHHH
Confidence 68999999999999999999999999999999999 999998653
|
| >3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} | Back alignment and structure |
|---|
| >4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A | Back alignment and structure |
|---|
| >4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >3chm_A COP9 signalosome complex subunit 7; heat/ARM repeats, winged helix motif, developmental protein, phosphoprotein; 1.50A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1ufm_A COP9 complex subunit 4; helix-turn-helix, structural genomics, riken structural genomics/proteomics initiative, RSGI, signaling protein; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} | Back alignment and structure |
|---|
| >1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A | Back alignment and structure |
|---|
| >4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} | Back alignment and structure |
|---|
| >2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* | Back alignment and structure |
|---|
| >3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A | Back alignment and structure |
|---|
| >1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A | Back alignment and structure |
|---|
| >1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A | Back alignment and structure |
|---|
| >2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A | Back alignment and structure |
|---|
| >2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} | Back alignment and structure |
|---|
| >1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A | Back alignment and structure |
|---|
| >3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A | Back alignment and structure |
|---|
| >1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 | Back alignment and structure |
|---|
| >2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A | Back alignment and structure |
|---|
| >4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} | Back alignment and structure |
|---|
| >2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
| >2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 | Back alignment and structure |
|---|
| >2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A | Back alignment and structure |
|---|
| >3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} | Back alignment and structure |
|---|
| >3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} | Back alignment and structure |
|---|
| >2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} | Back alignment and structure |
|---|
| >2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} | Back alignment and structure |
|---|
| >4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} | Back alignment and structure |
|---|
| >2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 | Back alignment and structure |
|---|
| >4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A | Back alignment and structure |
|---|
| >1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 | Back alignment and structure |
|---|
| >1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A | Back alignment and structure |
|---|
| >4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* | Back alignment and structure |
|---|
| >1wi9_A Protein C20ORF116 homolog; helix-turn-helix motif, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: a.4.5.47 | Back alignment and structure |
|---|
| >3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B | Back alignment and structure |
|---|
| >2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 258 | |||
| d1ufma_ | 84 | COP9 signalosome complex subunit 4, GSN4 {Mouse (M | 98.41 | |
| d2fbna1 | 153 | Putative 70 kda peptidylprolyl isomerase PFL2275c | 93.82 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 93.11 | |
| d1p5qa1 | 170 | FKBP52 (FKBP4), C-terminal domain {Human (Homo sap | 93.02 | |
| d1nzna_ | 122 | Mitochondria fission protein Fis1 {Human (Homo sap | 92.75 | |
| d1wi9a_ | 72 | Hypothetical protein C20orf116 homolog {Mouse (Mus | 92.14 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 91.88 | |
| d2cfxa1 | 63 | Transcriptional regulator LrpC {Bacillus subtilis | 91.74 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 91.59 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 90.89 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 90.73 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 90.3 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 89.83 | |
| d1tjca_ | 95 | Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human | 89.55 | |
| d1ihga1 | 169 | Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | 89.38 | |
| d2cg4a1 | 63 | Regulatory protein AsnC {Escherichia coli [TaxId: | 89.35 | |
| d1elwa_ | 117 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 89.04 | |
| d2c2la1 | 201 | STIP1 homology and U box-containing protein 1, STU | 88.94 | |
| d1kt1a1 | 168 | FKBP51, C-terminal domain {Monkey (Saimiri bolivie | 88.9 | |
| d1i1ga1 | 60 | LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 88.7 | |
| d1qqea_ | 290 | Vesicular transport protein sec17 {Baker's yeast ( | 88.6 | |
| d2cyya1 | 60 | Putative transcriptional regulator PH1519 {Archaeo | 88.31 | |
| d1a17a_ | 159 | Protein phosphatase 5 {Human (Homo sapiens) [TaxId | 88.23 | |
| d1fcha_ | 323 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 87.71 | |
| d1w3ba_ | 388 | O-GlcNAc transferase p110 subunit, OGT {Human (Hom | 86.27 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 85.55 | |
| d1hxia_ | 112 | Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 | 83.61 | |
| d1xnfa_ | 259 | Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | 83.19 | |
| d1hh8a_ | 192 | Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H | 83.1 | |
| d2pqrb1 | 124 | Mitochondria fission protein Fis1 {Baker's yeast ( | 81.4 | |
| d1elra_ | 128 | Hop {Human (Homo sapiens) [TaxId: 9606]} | 81.1 |
| >d1ufma_ a.4.5.47 (A:) COP9 signalosome complex subunit 4, GSN4 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: "Winged helix" DNA-binding domain family: PCI domain (PINT motif) domain: COP9 signalosome complex subunit 4, GSN4 species: Mouse (Mus musculus) [TaxId: 10090]
Probab=98.41 E-value=2.8e-07 Score=64.81 Aligned_cols=49 Identities=12% Similarity=0.292 Sum_probs=45.4
Q ss_pred CccccHHHHHHHHHhccCCCCHHHHHHHHHHHHHcCcceEEeecCceEEEEecC
Q 025104 192 AHQMKLDVIVKALKWLEMDMDVDEVECIVAILIHKNLVKGYFAHKSKVVVLSKQ 245 (258)
Q Consensus 192 ~~~i~l~~i~~al~~~~~~~~~~evE~ila~LI~~G~IkGyI~~~~~~lVlsk~ 245 (258)
+++|+++.++..+. ++.+++|.++++||.+|.|+|.||+.+++|.+.+.
T Consensus 28 Y~~Isl~~la~~l~-----l~~~evE~~l~~mI~~~~i~akIDq~~g~V~F~~~ 76 (84)
T d1ufma_ 28 YNNITFEELGALLE-----IPAAKAEKIASQMITEGRMNGFIDQIDGIVHFETR 76 (84)
T ss_dssp CSEEEHHHHHHHTT-----SCHHHHHHHHHHHHHTTSSCEEEETTTTEEEECCS
T ss_pred hceeeHHHHHHHHC-----CCHHHHHHHHHHHHhcCeEEEEEeCCCCEEEECCC
Confidence 48999999999997 78999999999999999999999999999998654
|
| >d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wi9a_ a.4.5.47 (A:) Hypothetical protein C20orf116 homolog {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} | Back information, alignment and structure |
|---|
| >d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} | Back information, alignment and structure |
|---|
| >d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|