Citrus Sinensis ID: 025145


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MSYSHQTVGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLPNIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPEDWEGLDASAAHIANLLSTEPADVKVGIGGFSMGAAVALYSATCCALGRYGNGIPYYVNLRAVVGLSGWLPGSRNLRNKIEGSHEAARRAASLPILLTHGLCDDVVPYKYGEKSANCLSISGFRHLTFKSFEGLGHYTVPKEMDEVCNWLTARLGLEGSRA
ccccccccccccccccccccccccEEEcccccccEEEEEECcccccccccHHHHHccccccEEEEcccccccccccccccccccccccccccccccHcHHHHHHHHHHHHHHHHcccccccEEEEEEcHHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccccHHHHHHccHHHHHHcccccEEEccccccccccHHHHHHHHHHHHHcccccEEEEEcccccccccHHHHHHHHHHHHHHcccccccc
******************FEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLPNIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPEDWEGLDASAAHIANLLSTEPADVKVGIGGFSMGAAVALYSATCCALGRYGNGIPYYVNLRAVVGLSGWLPGSRNLRNKI******ARRAASLPILLTHGLCDDVVPYKYGEKSANCLSISGFRHLTFKSFEGLGHYTVPKEMDEVCNWLTARLGL*****
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSYSHQTVGSGSRAARRTFEFGRTHVVRPKGKHQATIVWLHGLGDNGSSWSQLLESLPLPNIKWICPTAPTRPVAILGGFPCTAWFDVGELSDDGPEDWEGLDASAAHIANLLSTEPADVKVGIGGFSMGAAVALYSATCCALGRYGNGIPYYVNLRAVVGLSGWLPGSRNLRNKIEGSHEAARRAASLPILLTHGLCDDVVPYKYGEKSANCLSISGFRHLTFKSFEGLGHYTVPKEMDEVCNWLTARLGLEGSRA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Acyl-protein thioesterase 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates.probableQ6FW75
Acyl-protein thioesterase 1 homolog 1 Hydrolyzes fatty acids from S-acylated cysteine residues in proteins with a strong preference for palmitoylated G-alpha proteins over other acyl substrates.probableQ54T49

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3U0V, chain A
Confidence level:very confident
Coverage over the Query: 22-141,153-251
View the alignment between query and template
View the model in PyMOL