Query         025155
Match_columns 257
No_of_seqs    59 out of 61
Neff          2.4 
Searched_HMMs 46136
Date          Fri Mar 29 03:11:34 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025155.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025155hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN02343 allene oxide cyclase  100.0  9E-112  2E-116  742.0  21.0  194   60-257    36-229 (229)
  2 PF06351 Allene_ox_cyc:  Allene 100.0  1E-106  3E-111  688.9  14.5  176   77-255     1-176 (176)
  3 PF03018 Dirigent:  Dirigent-li  98.8 1.8E-07   4E-12   77.0  12.9   87  114-204    33-126 (144)
  4 cd06186 NOX_Duox_like_FAD_NADP  61.3     6.9 0.00015   31.9   2.4   13  180-192   107-119 (210)
  5 COG0543 UbiB 2-polyprenylpheno  52.9     9.6 0.00021   33.5   2.0   23  169-191    91-119 (252)
  6 PF08030 NAD_binding_6:  Ferric  47.8     9.2  0.0002   29.7   1.0   12  180-191     2-13  (156)
  7 cd00322 FNR_like Ferredoxin re  47.5      17 0.00036   29.4   2.4   25  168-192    80-110 (223)
  8 PRK05802 hypothetical protein;  46.3      15 0.00033   33.7   2.3   26  167-192   149-185 (320)
  9 cd06187 O2ase_reductase_like T  43.4      19 0.00042   29.5   2.3   12  180-191    99-110 (224)
 10 PF04004 Leo1:  Leo1-like prote  41.7 1.9E+02  0.0042   24.6   8.1   62  131-193    38-113 (171)
 11 cd06183 cyt_b5_reduct_like Cyt  41.6      19 0.00041   29.5   2.0   12  180-191   105-116 (234)
 12 cd06191 FNR_iron_sulfur_bindin  39.8      24 0.00051   29.4   2.3   12  180-191   103-114 (231)
 13 cd06184 flavohem_like_fad_nad_  38.3      24 0.00052   29.7   2.1   25  168-192    96-126 (247)
 14 cd06196 FNR_like_1 Ferredoxin   38.2      25 0.00055   28.9   2.2   23  169-191    87-111 (218)
 15 cd06197 FNR_like_2 FAD/NAD(P)   37.3      27 0.00059   29.6   2.3   13  179-191   125-137 (220)
 16 PTZ00274 cytochrome b5 reducta  36.6      28 0.00061   32.3   2.5   24  168-191   142-171 (325)
 17 cd06190 T4MO_e_transfer_like T  36.0      28 0.00061   28.9   2.2   23  169-191    81-109 (232)
 18 PRK08564 5'-methylthioadenosin  35.8      33 0.00071   31.3   2.7   55  181-235     8-69  (267)
 19 KOG0534 NADH-cytochrome b-5 re  35.6      28 0.00061   32.6   2.3   25  167-191   138-168 (286)
 20 cd06220 DHOD_e_trans_like2 FAD  33.1      36 0.00078   28.8   2.4   23  169-191    74-100 (233)
 21 cd06209 BenDO_FAD_NAD Benzoate  32.6      35 0.00075   28.4   2.2   13  180-192   103-115 (228)
 22 cd06198 FNR_like_3 NAD(P) bind  32.5      36 0.00079   28.0   2.3   14  179-192    95-108 (216)
 23 cd06195 FNR1 Ferredoxin-NADP+   31.8      35 0.00076   28.7   2.1   12  180-191   102-113 (241)
 24 cd06217 FNR_iron_sulfur_bindin  31.6      41 0.00088   27.8   2.4   12  180-191   108-119 (235)
 25 PF13363 BetaGal_dom3:  Beta-ga  31.5      32  0.0007   26.8   1.7   23  167-189    16-42  (79)
 26 PRK00054 dihydroorotate dehydr  31.0      40 0.00087   28.9   2.4   24  168-191    85-114 (250)
 27 cd06192 DHOD_e_trans_like FAD/  30.0      43 0.00093   28.4   2.4   24  168-191    80-109 (243)
 28 cd06213 oxygenase_e_transfer_s  29.1      45 0.00097   27.8   2.3   12  180-191   101-112 (227)
 29 PRK08345 cytochrome-c3 hydroge  29.1      45 0.00097   29.7   2.4   25  168-192    90-121 (289)
 30 PRK07609 CDP-6-deoxy-delta-3,4  28.6      45 0.00098   29.8   2.4   25  168-192   187-217 (339)
 31 cd06215 FNR_iron_sulfur_bindin  28.5      48   0.001   27.3   2.4   13  180-192   104-116 (231)
 32 cd06216 FNR_iron_sulfur_bindin  28.4      43 0.00093   28.2   2.1   13  180-192   123-135 (243)
 33 PRK08051 fre FMN reductase; Va  27.7      52  0.0011   27.8   2.5   12  180-191   103-114 (232)
 34 PLN02292 ferric-chelate reduct  27.7      43 0.00093   34.9   2.3   24  169-192   415-444 (702)
 35 PRK07823 5'-methylthioadenosin  27.5      50  0.0011   30.3   2.5   38  182-220     7-49  (264)
 36 smart00797 AHS2 Allophanate hy  27.3      62  0.0013   30.0   3.1   21  169-189    33-54  (280)
 37 cd06212 monooxygenase_like The  27.3      49  0.0011   27.6   2.2   13  180-192   104-116 (232)
 38 PLN02844 oxidoreductase/ferric  26.5      46   0.001   34.8   2.3   23  169-191   407-435 (722)
 39 cd06194 FNR_N-term_Iron_sulfur  26.3      58  0.0013   26.9   2.5   24  168-191    79-109 (222)
 40 TIGR01697 PNPH-PUNA-XAPA inosi  26.1      43 0.00092   29.6   1.8   36  183-220     2-52  (248)
 41 TIGR02911 sulfite_red_B sulfit  26.0      56  0.0012   28.6   2.5   24  168-191    81-111 (261)
 42 PLN02631 ferric-chelate reduct  25.8      52  0.0011   34.3   2.5   24  168-191   395-424 (699)
 43 cd06221 sulfite_reductase_like  25.6      57  0.0012   28.2   2.4   25  168-192    80-111 (253)
 44 PLN03116 ferredoxin--NADP+ red  25.4      59  0.0013   29.3   2.5   24  168-191   137-168 (307)
 45 cd06189 flavin_oxioreductase N  24.5      56  0.0012   27.1   2.1   13  180-192    99-111 (224)
 46 PRK06171 sorbitol-6-phosphate   24.1      46   0.001   27.7   1.5   20  172-191     1-20  (266)
 47 cd06188 NADH_quinone_reductase  24.0      63  0.0014   28.3   2.4   12  180-191   151-162 (283)
 48 cd06211 phenol_2-monooxygenase  23.5      63  0.0014   27.2   2.2   12  180-191   110-121 (238)
 49 PRK13838 conjugal transfer pil  23.4 2.2E+02  0.0047   24.6   5.5   44  113-157    51-102 (176)
 50 cd06210 MMO_FAD_NAD_binding Me  23.1      64  0.0014   26.9   2.2   12  180-191   109-120 (236)
 51 PTZ00319 NADH-cytochrome B5 re  22.1      70  0.0015   28.8   2.3   11  181-191   168-178 (300)
 52 cd06219 DHOD_e_trans_like1 FAD  21.2      73  0.0016   27.4   2.2   22  170-191    83-109 (248)
 53 PRK08221 anaerobic sulfite red  21.1      75  0.0016   27.9   2.3   12  180-191   102-113 (263)
 54 PRK13289 bifunctional nitric o  21.0      77  0.0017   28.9   2.4   24  168-191   244-273 (399)
 55 TIGR02160 PA_CoA_Oxy5 phenylac  20.8      67  0.0015   28.9   2.0   12  180-191   110-121 (352)
 56 cd06193 siderophore_interactin  20.8      77  0.0017   27.0   2.2   24  168-191   104-132 (235)
 57 cd06218 DHOD_e_trans FAD/NAD b  20.5      81  0.0018   27.2   2.3   13  180-192    99-111 (246)
 58 PF02141 DENN:  DENN (AEX-3) do  20.5      16 0.00035   30.2  -1.9   31  201-235   127-157 (185)

No 1  
>PLN02343 allene oxide cyclase
Probab=100.00  E-value=8.5e-112  Score=741.99  Aligned_cols=194  Identities=75%  Similarity=1.225  Sum_probs=190.1

Q ss_pred             CccceeEEeeCCCCCCCCCCccccceeEEEEEEecccCCCCcceEeeCCCcccccccCccccccccccccccceeceeee
Q 025155           60 NVTTKAFFFNKPSSQPDSSRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGITAG  139 (257)
Q Consensus        60 ~~~~~~~~~~~~~~~~~~~~p~~~kvqel~vyeiNE~dr~SPa~L~ls~k~~~nslGDlVpFsNkLY~g~l~kRiGitaG  139 (257)
                      ..++++|+|++++.  ++++|+  |||||+|||||||||+|||||||++|+++|+|||||||+||||+|||+||||||||
T Consensus        36 ~~s~~~~~~~~~~~--~~~~p~--kvQel~VYEiNErDR~SPa~L~ls~k~~~~sLGDlVPFsNKlY~g~L~kRlGiTaG  111 (229)
T PLN02343         36 NLTVTRALFSNKAN--ENPRPT--KVQELSVYEINERDRGSPAFLKLSKKSVENALGDLVPFTNKLYTGDLKKRLGITAG  111 (229)
T ss_pred             cccceeeeeccccc--CCCCCc--eeEEEEEEEeccccCCCcceEEcccCcccccccceeccccccccchhhhhhcccce
Confidence            34578999999987  889999  99999999999999999999999999999999999999999999999999999999


Q ss_pred             eEEEEeeccCCCCCEEEEEEEEEeecCceEEEeceeccccccEEEEeccceeeeeeeeEEEEEEeeeceeEEEEEEeccC
Q 025155          140 LCVLIKHEPEKKGDRFEAIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLHQIVFPYKLFYTFYLKGV  219 (257)
Q Consensus       140 ~Cvliq~~pek~GdryEa~ySfyFGDyGhISvqGpylt~eDtyLAVTGGTGiFeGa~GqVkL~qivfPfklfYtFyLkgi  219 (257)
                      +|++|||+|||+||||||||||||||||||||||||+||||||||||||+||||||||||||||||||||||||||||||
T Consensus       112 ~Cvliq~~pek~gDryEa~ySfyfGDyGHisvqGpyltyeDt~LaiTGGsGiFega~GqvkL~qivfPfKlfYTFyLkGi  191 (229)
T PLN02343        112 LCVLIQHVPEKKGDRYEAIYSFYFGDYGHISVQGPYLTYEDTYLAITGGSGIFEGAYGQVKLHQIVFPFKLFYTFYLKGI  191 (229)
T ss_pred             eEEEEEeccccCCceeEEEEEEEecCcceeEEeccccccccceEEeecCcceeecceeEEEEeeeeeeeeeEEEEEeccc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCChhhhhcCCCCCCCCCccChhhhccCCccccCCCCC
Q 025155          220 ADLPQELLVKPVEPSPTVEAAPAAKATEPHAAISNFTN  257 (257)
Q Consensus       220 ~dlp~el~~~~v~ps~~vep~p~aka~~p~a~~~nft~  257 (257)
                      ||||+||+++||+|||+|||+|+|||||||++++||||
T Consensus       192 ~dLP~eL~~~~v~Ps~~Vep~p~Aka~~p~~~~~nfT~  229 (229)
T PLN02343        192 PDLPEELTGTPVPPSPDVEPAPEAKACEPSSVIPNFTN  229 (229)
T ss_pred             ccchHHHhCCCCCCCCCCCcChhHhhcCCCccccccCC
Confidence            99999999999999999999999999999999999997


No 2  
>PF06351 Allene_ox_cyc:  Allene oxide cyclase;  InterPro: IPR009410 This family consists of several plant specific allene oxide cyclase proteins (5.3.99.6 from EC). The allene oxide cyclase (AOC)-catalysed step in jasmonate (JA) biosynthesis is important in the wound response of tomato [].; GO: 0016853 isomerase activity, 0009507 chloroplast; PDB: 2GIN_A 2DIO_B 2BRJ_B 2Q4I_B 1Z8K_A 1ZVC_A.
Probab=100.00  E-value=1.2e-106  Score=688.87  Aligned_cols=176  Identities=83%  Similarity=1.345  Sum_probs=137.9

Q ss_pred             CCCccccceeEEEEEEecccCCCCcceEeeCCCcccccccCccccccccccccccceeceeeeeEEEEeeccCCCCCEEE
Q 025155           77 SSRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGITAGLCVLIKHEPEKKGDRFE  156 (257)
Q Consensus        77 ~~~p~~~kvqel~vyeiNE~dr~SPa~L~ls~k~~~nslGDlVpFsNkLY~g~l~kRiGitaG~Cvliq~~pek~GdryE  156 (257)
                      +++|+  |||||+|||||||||+||||||||||++ |+|||||||+||||+||||+|||||+|+|++|||+|||+|||||
T Consensus         1 ~~~p~--kvqel~vyeiNErdR~SPa~L~ls~k~~-nslGDlvpFsNklY~g~l~~rlGitaG~Cvliq~~p~k~GdryE   77 (176)
T PF06351_consen    1 SSRPT--KVQELSVYEINERDRGSPAYLRLSQKSV-NSLGDLVPFSNKLYDGDLQKRLGITAGICVLIQHVPEKKGDRYE   77 (176)
T ss_dssp             ---------EEEEEEEE--S-S--S--B--SSSSS-S-TT-EEEEEEEEEETTSS-EEEEEEEEEEEEEEECCCTEEEEE
T ss_pred             CCCcc--ceEEEEEEEEcccccCCCcEEEcccccc-hhcccccccccccccchhhhhhcccceEEEEEEeccccCCceEE
Confidence            46788  9999999999999999999999999999 99999999999999999999999999999999999999999999


Q ss_pred             EEEEEEeecCceEEEeceeccccccEEEEeccceeeeeeeeEEEEEEeeeceeEEEEEEeccCCCChhhhhcCCCCCCCC
Q 025155          157 AIYSFYFGDYGHISVQGAYLTYEDTYLAVTGGSGIFEGVYGQVKLHQIVFPYKLFYTFYLKGVADLPQELLVKPVEPSPT  236 (257)
Q Consensus       157 a~ySfyFGDyGhISvqGpylt~eDtyLAVTGGTGiFeGa~GqVkL~qivfPfklfYtFyLkgi~dlp~el~~~~v~ps~~  236 (257)
                      |+|||||||||||||||||+|||||||||||||||||||||||||||||||||||||||||||||||+||+++||+|||+
T Consensus        78 aiySfyfGdyGhISvqGpy~t~eDtyLAVTGGtGiF~g~~GqVkL~qivfPfKlfYTFylkGi~dLP~el~~~~v~Ps~~  157 (176)
T PF06351_consen   78 AIYSFYFGDYGHISVQGPYLTYEDTYLAVTGGTGIFEGVYGQVKLHQIVFPFKLFYTFYLKGIPDLPEELLGKPVEPSPA  157 (176)
T ss_dssp             EEEEEE-GGGEEEEEEEEEETTS-EEEEEEEEEETTTT-EEEEEEEEEETTTEEEEEEEEES-S---GGGHS-----STT
T ss_pred             EEEEEEecccceEEEecccccccceeEEEeccCceeecceEEEEEEEeecceEEEEEEEecccccccHHHhCCCCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccChhhhccCCccccCCC
Q 025155          237 VEAAPAAKATEPHAAISNF  255 (257)
Q Consensus       237 vep~p~aka~~p~a~~~nf  255 (257)
                      |||+|+||||||||+++||
T Consensus       158 vep~p~Aka~~p~a~~~nf  176 (176)
T PF06351_consen  158 VEPSPAAKACEPHAVIPNF  176 (176)
T ss_dssp             ----HHHHCT-GGGB-TT-
T ss_pred             CCcChHHhhcCCcccccCC
Confidence            9999999999999999998


No 3  
>PF03018 Dirigent:  Dirigent-like protein;  InterPro: IPR004265 This family contains a number of proteins which are induced during disease response in plants.
Probab=98.77  E-value=1.8e-07  Score=76.98  Aligned_cols=87  Identities=30%  Similarity=0.411  Sum_probs=76.2

Q ss_pred             cccCccccccccccccc--cceeceeeeeEEEEeeccCCCCCEEEEEEEEEeecC---c-eEEEeceec-cccccEEEEe
Q 025155          114 TIGDLVPFTNKLYTGDL--QKRIGITAGLCVLIKHEPEKKGDRFEAIYSFYFGDY---G-HISVQGAYL-TYEDTYLAVT  186 (257)
Q Consensus       114 slGDlVpFsNkLY~g~l--~kRiGitaG~Cvliq~~pek~GdryEa~ySfyFGDy---G-hISvqGpyl-t~eDtyLAVT  186 (257)
                      ..|+++-|.++|++|-.  -+.||--+|+.+.-    ...|..+-..+++.|-+.   | +|+|+|... .-+..-+||+
T Consensus        33 ~FG~~~V~D~~lt~gp~~~S~~VGraqG~~~~~----s~~~~~~~~~~~~vF~~g~~~GStl~v~G~~~~~~~~~e~~VV  108 (144)
T PF03018_consen   33 GFGTVVVFDDPLTEGPDPDSKLVGRAQGFYVSA----SLDGSSWFMSFTLVFEDGEYNGSTLSVMGRDPFFEPVRELAVV  108 (144)
T ss_pred             CCcEEEEEeeceEcCCCCCCccceEEEEEEEee----cccCccEEEEEEEEEEecccCCCeEEEeCCCcccCcccEEeEe
Confidence            78999999999998854  78999999999996    456788999999999772   6 899999985 4466799999


Q ss_pred             ccceeeeeeeeEEEEEEe
Q 025155          187 GGSGIFEGVYGQVKLHQI  204 (257)
Q Consensus       187 GGTGiFeGa~GqVkL~qi  204 (257)
                      ||||-|+.|+|.+++..+
T Consensus       109 GGTG~Fr~ArG~~~~~~~  126 (144)
T PF03018_consen  109 GGTGEFRMARGYAKLRTV  126 (144)
T ss_pred             cCCCeEcceEEEEEEEEE
Confidence            999999999999999887


No 4  
>cd06186 NOX_Duox_like_FAD_NADP NADPH oxidase (NOX) catalyzes the generation of reactive oxygen species (ROS) such as superoxide and hydrogen peroxide. ROS were originally identified as bactericidal agents in phagocytes, but are now also implicated in cell signaling and metabolism. NOX has a 6-alpha helix heme-binding transmembrane domain fused to a flavoprotein with the nucleotide binding domain located in the cytoplasm. Duox enzymes link a peroxidase domain to the NOX domain via a single  transmembrane and EF-hand Ca2+ binding sites. The flavoprotein module has a ferredoxin like FAD/NADPH binding domain. In classical phagocytic NOX2, electron transfer occurs from NADPH to FAD to the heme of cytb to oxygen leading to superoxide formation.
Probab=61.35  E-value=6.9  Score=31.88  Aligned_cols=13  Identities=62%  Similarity=0.889  Sum_probs=11.2

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +..+-|.||+||=
T Consensus       107 ~~~vliagG~GIt  119 (210)
T cd06186         107 DNVLLVAGGSGIT  119 (210)
T ss_pred             CeEEEEeccccHh
Confidence            5789999999983


No 5  
>COG0543 UbiB 2-polyprenylphenol hydroxylase and related flavodoxin oxidoreductases [Coenzyme metabolism / Energy production and conversion]
Probab=52.93  E-value=9.6  Score=33.50  Aligned_cols=23  Identities=35%  Similarity=0.440  Sum_probs=19.4

Q ss_pred             EEEeceecccccc------EEEEecccee
Q 025155          169 ISVQGAYLTYEDT------YLAVTGGSGI  191 (257)
Q Consensus       169 ISvqGpylt~eDt------yLAVTGGTGi  191 (257)
                      |.+.|||=+.-+-      .|.|-||+|+
T Consensus        91 i~v~GP~G~~~~~~~~~~~vlliagGtG~  119 (252)
T COG0543          91 IRVRGPLGNGFLREKIGKPVLLIAGGTGI  119 (252)
T ss_pred             EEEEcCCCCCccccccCCcEEEEecccCH
Confidence            8999999876332      8999999998


No 6  
>PF08030 NAD_binding_6:  Ferric reductase NAD binding domain;  InterPro: IPR013121 This entry contains ferric reductase NAD binding proteins.; GO: 0016491 oxidoreductase activity, 0055114 oxidation-reduction process; PDB: 3A1F_A.
Probab=47.78  E-value=9.2  Score=29.72  Aligned_cols=12  Identities=58%  Similarity=0.963  Sum_probs=10.6

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      |+.+.|.||+||
T Consensus         2 ~~vvlvAGG~GI   13 (156)
T PF08030_consen    2 DNVVLVAGGSGI   13 (156)
T ss_dssp             SEEEEEEEGGGH
T ss_pred             CEEEEEecCcCH
Confidence            678899999997


No 7  
>cd00322 FNR_like Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation in many organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal moeity may contain a flavin prosthetic group (as in 
Probab=47.47  E-value=17  Score=29.38  Aligned_cols=25  Identities=24%  Similarity=0.458  Sum_probs=17.1

Q ss_pred             eEEEeceeccc------cccEEEEeccceee
Q 025155          168 HISVQGAYLTY------EDTYLAVTGGSGIF  192 (257)
Q Consensus       168 hISvqGpylt~------eDtyLAVTGGTGiF  192 (257)
                      .|.+.||+=++      .+.++.|.||+||=
T Consensus        80 ~v~i~gP~G~~~~~~~~~~~~v~ia~G~Gia  110 (223)
T cd00322          80 EVEVSGPGGDFFLPLEESGPVVLIAGGIGIT  110 (223)
T ss_pred             EEEEECCCcccccCcccCCcEEEEecCCchh
Confidence            45555555443      35689999999984


No 8  
>PRK05802 hypothetical protein; Provisional
Probab=46.25  E-value=15  Score=33.72  Aligned_cols=26  Identities=27%  Similarity=0.469  Sum_probs=19.1

Q ss_pred             ceEEEecee----ccc-------cccEEEEeccceee
Q 025155          167 GHISVQGAY----LTY-------EDTYLAVTGGSGIF  192 (257)
Q Consensus       167 GhISvqGpy----lt~-------eDtyLAVTGGTGiF  192 (257)
                      ..|.|.|||    +..       ....+.|.||+||-
T Consensus       149 d~l~v~GP~GnG~F~l~~~~~~~~~~~llIaGGiGIa  185 (320)
T PRK05802        149 DEILLRGPYWNGILGLKNIKSTKNGKSLVIARGIGQA  185 (320)
T ss_pred             CEEEEeCCCCcCcCCcccccccCCCeEEEEEeEEeHH
Confidence            368999997    321       23689999999983


No 9  
>cd06187 O2ase_reductase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons using oxygen as the oxidant. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate, while mono-oxygenases (aka mixed oxygenases) add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with Rieske type  [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=43.41  E-value=19  Score=29.51  Aligned_cols=12  Identities=33%  Similarity=0.861  Sum_probs=10.6

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus        99 ~~~lliagG~GI  110 (224)
T cd06187          99 RPVLCIAGGTGL  110 (224)
T ss_pred             CCEEEEecCcCH
Confidence            468999999998


No 10 
>PF04004 Leo1:  Leo1-like protein;  InterPro: IPR007149 Members of this family are part of the Paf1/RNA polymerase II complex [, ]. The Paf1 complex probably functions during the elongation phase of transcription [].
Probab=41.69  E-value=1.9e+02  Score=24.64  Aligned_cols=62  Identities=23%  Similarity=0.483  Sum_probs=41.1

Q ss_pred             cceeceeeeeEEEEeeccCCCCC----------EEE-EEEEEEeecCceEEEeceecccc--ccEEEEeccc-eeee
Q 025155          131 QKRIGITAGLCVLIKHEPEKKGD----------RFE-AIYSFYFGDYGHISVQGAYLTYE--DTYLAVTGGS-GIFE  193 (257)
Q Consensus       131 ~kRiGitaG~Cvliq~~pek~Gd----------ryE-a~ySfyFGDyGhISvqGpylt~e--DtyLAVTGGT-GiFe  193 (257)
                      ..|+-...-.+|+-...+...|.          ||+ -.+|+..|| -+.-|+..|-..+  .+||+|--++ ++++
T Consensus        38 ~~~~~~~~~ntIRWR~~~~~~g~~~~eSNAriVrWsDGS~sL~iG~-E~fdi~~~~~~~~~~~~~L~~~~~~~~~l~  113 (171)
T PF04004_consen   38 RERLKLKVENTIRWRYSPDETGEKVKESNARIVRWSDGSLSLHIGN-EVFDIQKKYPLVQDDHNYLFVRHGSSGVLQ  113 (171)
T ss_pred             hhhhccccccEEEEeecCCCCCCEeeecccEEEEEcCCceEEEecc-EEEEeccccccccCCcceEEEEcCCcceEE
Confidence            45555655566776666656665          566 788999996 4666645554444  3899998774 6665


No 11 
>cd06183 cyt_b5_reduct_like Cytochrome b5 reductase catalyzes the reduction of 2 molecules of cytochrome b5 using NADH as an electron donor. Like ferredoxin reductases, these proteins have an N-terminal FAD binding subdomain and a C-terminal NADH binding subdomain, separated by a cleft, which accepts FAD. The NADH-binding moiety interacts with part of the FAD and resembles a Rossmann fold. However, NAD is bound differently than in canonical Rossmann fold proteins. Nitrate reductases, flavoproteins similar to pyridine nucleotide cytochrome reductases, catalyze the reduction of nitrate to nitrite. The enzyme can be divided into three functional fragments that bind the cofactors molybdopterin, heme-iron, and FAD/NADH.
Probab=41.60  E-value=19  Score=29.54  Aligned_cols=12  Identities=33%  Similarity=0.650  Sum_probs=10.8

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus       105 ~~~vliagGtGi  116 (234)
T cd06183         105 KHIGMIAGGTGI  116 (234)
T ss_pred             cEEEEEcCCcch
Confidence            568999999999


No 12 
>cd06191 FNR_iron_sulfur_binding Iron-sulfur binding Ferredoxin Reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with a C-terminal iron-sulfur binding cluster domain. FNR was intially identified as a chloroplast reductase activity catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methnae assimilation in a variety of organisms. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which vary in
Probab=39.79  E-value=24  Score=29.42  Aligned_cols=12  Identities=58%  Similarity=0.955  Sum_probs=10.8

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus       103 ~~~lliagG~Gi  114 (231)
T cd06191         103 GRYLLVAAGSGI  114 (231)
T ss_pred             CcEEEEecCccH
Confidence            578999999998


No 13 
>cd06184 flavohem_like_fad_nad_binding FAD_NAD(P)H binding domain of flavohemoglobin. Flavohemoglobins have a globin domain containing a B-type heme fused with a ferredoxin reductase-like FAD/NAD-binding domain. Flavohemoglobins detoxify nitric oxide (NO) via an NO dioxygenase reaction. The hemoglobin domain adopts a globin fold with an embedded heme molecule. Flavohemoglobins also have a C-terminal reductase domain with bindiing sites for FAD and NAD(P)H. This domain catalyzes the conversion of NO + O2 + NAD(P)H to NO3- + NAD(P)+.  Instead of the oxygen transport function of hemoglobins, flavohemoglobins seem to act in NO dioxygenation and NO signalling.
Probab=38.30  E-value=24  Score=29.69  Aligned_cols=25  Identities=16%  Similarity=0.349  Sum_probs=17.7

Q ss_pred             eEEEeceeccc------cccEEEEeccceee
Q 025155          168 HISVQGAYLTY------EDTYLAVTGGSGIF  192 (257)
Q Consensus       168 hISvqGpylt~------eDtyLAVTGGTGiF  192 (257)
                      .+.|.|||=.+      .+.++.|.|||||-
T Consensus        96 ~v~i~gP~G~~~~~~~~~~~llliagGtGia  126 (247)
T cd06184          96 VLEVSAPAGDFVLDEASDRPLVLISAGVGIT  126 (247)
T ss_pred             EEEEEcCCCceECCCCCCCcEEEEeccccHh
Confidence            56677775432      24689999999983


No 14 
>cd06196 FNR_like_1 Ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which varies in orientation with respect to the NAD(P) binding domain. The N-terminal region may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=38.16  E-value=25  Score=28.89  Aligned_cols=23  Identities=17%  Similarity=0.450  Sum_probs=14.8

Q ss_pred             EEEeceeccc--cccEEEEecccee
Q 025155          169 ISVQGAYLTY--EDTYLAVTGGSGI  191 (257)
Q Consensus       169 ISvqGpylt~--eDtyLAVTGGTGi  191 (257)
                      |.+.|||=++  .+..+.|.||+||
T Consensus        87 v~i~gP~G~~~~~~~~vlia~GtGi  111 (218)
T cd06196          87 LLIEDPWGAIEYKGPGVFIAGGAGI  111 (218)
T ss_pred             EEEECCccceEecCceEEEecCCCc
Confidence            4444444433  2467899999997


No 15 
>cd06197 FNR_like_2 FAD/NAD(P) binding domain of  ferredoxin reductase-like proteins. Ferredoxin reductase (FNR) was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and have a variety of physiological  functions in a variety of organisms including nitrogen assimilation, dinitrogen fixation, steroid hydroxylation, fatty acid metabolism, oxygenase activity, and methane assimilation. FNR has an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) flavin sub-domain which varies in orientation with respect  to the NAD(P) binding domain. The N-terminal moeity 
Probab=37.31  E-value=27  Score=29.62  Aligned_cols=13  Identities=38%  Similarity=0.716  Sum_probs=11.3

Q ss_pred             cccEEEEecccee
Q 025155          179 EDTYLAVTGGSGI  191 (257)
Q Consensus       179 eDtyLAVTGGTGi  191 (257)
                      .+..+.|.||+||
T Consensus       125 ~~~illIagG~GI  137 (220)
T cd06197         125 ERKMVWIAGGVGI  137 (220)
T ss_pred             CceEEEEecccch
Confidence            4578999999998


No 16 
>PTZ00274 cytochrome b5 reductase; Provisional
Probab=36.58  E-value=28  Score=32.27  Aligned_cols=24  Identities=13%  Similarity=0.325  Sum_probs=17.5

Q ss_pred             eEEEeceeccc--c----ccEEEEecccee
Q 025155          168 HISVQGAYLTY--E----DTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt~--e----DtyLAVTGGTGi  191 (257)
                      .|.|.||+.++  +    +.++.|.|||||
T Consensus       142 ~v~v~GP~f~~~~~~~~~~~lvlIAGGsGI  171 (325)
T PTZ00274        142 KLLFRSVTFKIQYRPNRWKHVGMIAGGTGF  171 (325)
T ss_pred             EEEEeCCeeecccCCCCCceEEEEeCCcch
Confidence            56677775543  1    458999999998


No 17 
>cd06190 T4MO_e_transfer_like Toluene-4-monoxygenase electron transfer component of Pseudomonas mendocina hydroxylates toluene and forms p-cresol as part of a three component toluene-4-monoxygenase system. Electron transfer is from NADH to an NADH:ferredoxin oxidoreductase (TmoF in P. mendocina) to ferredoxin to an iron-containing oxygenase. TmoF is homologous to other mono- and dioxygenase systems within the ferredoxin reductase family.
Probab=36.02  E-value=28  Score=28.91  Aligned_cols=23  Identities=26%  Similarity=0.653  Sum_probs=15.8

Q ss_pred             EEEeceeccc------cccEEEEecccee
Q 025155          169 ISVQGAYLTY------EDTYLAVTGGSGI  191 (257)
Q Consensus       169 ISvqGpylt~------eDtyLAVTGGTGi  191 (257)
                      |.|.|||=++      .+.++.|.||+||
T Consensus        81 v~v~gP~G~~~~~~~~~~~illIagG~Gi  109 (232)
T cd06190          81 LELDGPYGLAYLRPDEDRDIVCIAGGSGL  109 (232)
T ss_pred             EEEECCcccceecCCCCCcEEEEeeCcCH
Confidence            5566665432      3468999999997


No 18 
>PRK08564 5'-methylthioadenosine phosphorylase II; Reviewed
Probab=35.79  E-value=33  Score=31.34  Aligned_cols=55  Identities=24%  Similarity=0.461  Sum_probs=31.4

Q ss_pred             cEEEEeccceeee-eeeeEEEEEEeeeceeE----EEEEEeccCC--CChhhhhcCCCCCCC
Q 025155          181 TYLAVTGGSGIFE-GVYGQVKLHQIVFPYKL----FYTFYLKGVA--DLPQELLVKPVEPSP  235 (257)
Q Consensus       181 tyLAVTGGTGiFe-Ga~GqVkL~qivfPfkl----fYtFyLkgi~--dlp~el~~~~v~ps~  235 (257)
                      .-+||.||||+++ |.-...+-..+.-||.-    +.--+|.|.+  =||+.=..-..+|+.
T Consensus         8 ~~igiIgGSGl~~~~~l~~~~~~~~~tpyg~p~~~l~~g~l~g~~v~~l~RhGr~H~y~~~~   69 (267)
T PRK08564          8 ASIGIIGGSGLYDPGIFENSKEVKVYTPYGEPSDNIIIGEIEGVEVAFLPRHGRGHRIPPHK   69 (267)
T ss_pred             ceEEEEecCCCCCCcccccceeeeEEcCCCCCccCEEEEEECCEEEEEEeCCCCCcccCCcc
Confidence            3689999999987 44344444566678862    3334566654  333332333444443


No 19 
>KOG0534 consensus NADH-cytochrome b-5 reductase [Coenzyme transport and metabolism; Energy production and conversion]
Probab=35.57  E-value=28  Score=32.61  Aligned_cols=25  Identities=20%  Similarity=0.511  Sum_probs=19.7

Q ss_pred             ceEEEeceeccc--c----ccEEEEecccee
Q 025155          167 GHISVQGAYLTY--E----DTYLAVTGGSGI  191 (257)
Q Consensus       167 GhISvqGpylt~--e----DtyLAVTGGTGi  191 (257)
                      ..|.|.||.-++  +    .....|.|||||
T Consensus       138 d~ve~rGP~G~~~~~~~~~~~l~miAgGtGI  168 (286)
T KOG0534|consen  138 DTVEFRGPIGEFKYDPQKAKHLGMIAGGTGI  168 (286)
T ss_pred             CEEEEecCccceEecCCCcceEEEEecccch
Confidence            468899997655  2    458899999998


No 20 
>cd06220 DHOD_e_trans_like2 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=33.07  E-value=36  Score=28.81  Aligned_cols=23  Identities=30%  Similarity=0.634  Sum_probs=15.6

Q ss_pred             EEEeceecc---c-cccEEEEecccee
Q 025155          169 ISVQGAYLT---Y-EDTYLAVTGGSGI  191 (257)
Q Consensus       169 ISvqGpylt---~-eDtyLAVTGGTGi  191 (257)
                      |.+.|||=+   . .+..+.|.||+||
T Consensus        74 v~i~gP~G~~f~~~~~~~vliAgGtGi  100 (233)
T cd06220          74 LGIRGPYGNGFELVGGKVLLIGGGIGI  100 (233)
T ss_pred             EEEECcCCCCccCCCCeEEEEecCcCh
Confidence            445555422   1 4678999999997


No 21 
>cd06209 BenDO_FAD_NAD Benzoate dioxygenase reductase (BenDO) FAD/NAD binding domain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. As a Class I bacterial dioxygenases, benzoate dioxygenase like proteins combine an [2Fe-2S] cluster containing N-terminal ferredoxin at the end fused to an FAD/NADP(P) domain.  In dioxygenase FAD/NAD(P) binding domain, the reductase transfers 2 electrons from NAD(P)H to the oxygenase which insert into an aromatic substrate, an initial step in microbial aerobic degradation of aromatic rings. Flavin oxidoreductases use flavins as substrates, unlike flavoenzymes which have a flavin prosthetic group.
Probab=32.64  E-value=35  Score=28.38  Aligned_cols=13  Identities=31%  Similarity=0.700  Sum_probs=11.0

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +.++.|.||+||=
T Consensus       103 ~~~vlia~GtGIa  115 (228)
T cd06209         103 RPLLMLAGGTGLA  115 (228)
T ss_pred             CeEEEEEcccCHh
Confidence            5689999999983


No 22 
>cd06198 FNR_like_3 NAD(P) binding domain of  ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding sub-domain of the alpha/beta class and a discrete (usually N-terminal) domain, which varies in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) which then transfers a hydride ion to convert NADP+ to NADPH.
Probab=32.49  E-value=36  Score=28.01  Aligned_cols=14  Identities=29%  Similarity=0.498  Sum_probs=11.7

Q ss_pred             cccEEEEeccceee
Q 025155          179 EDTYLAVTGGSGIF  192 (257)
Q Consensus       179 eDtyLAVTGGTGiF  192 (257)
                      .+.++.|.||+||=
T Consensus        95 ~~~~vlia~GtGia  108 (216)
T cd06198          95 RARQIWIAGGIGIT  108 (216)
T ss_pred             CceEEEEccccCHH
Confidence            35789999999984


No 23 
>cd06195 FNR1 Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form FADH2 which then transfers two electrons and a proton to NADP+ to form NADPH.
Probab=31.77  E-value=35  Score=28.69  Aligned_cols=12  Identities=25%  Similarity=0.512  Sum_probs=10.7

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +..+-|.||+||
T Consensus       102 ~~~vlIagGtGi  113 (241)
T cd06195         102 KRLWLLATGTGI  113 (241)
T ss_pred             ceEEEEeeccch
Confidence            568999999998


No 24 
>cd06217 FNR_iron_sulfur_binding_3 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap between the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to form 
Probab=31.64  E-value=41  Score=27.84  Aligned_cols=12  Identities=50%  Similarity=0.908  Sum_probs=10.7

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus       108 ~~~vliagG~Gi  119 (235)
T cd06217         108 DPVVLLAGGSGI  119 (235)
T ss_pred             ceEEEEecCcCc
Confidence            568899999999


No 25 
>PF13363 BetaGal_dom3:  Beta-galactosidase, domain 3; PDB: 3OGS_A 3OGV_A 3OGR_A 3OG2_A 1TG7_A 1XC6_A.
Probab=31.52  E-value=32  Score=26.84  Aligned_cols=23  Identities=30%  Similarity=0.557  Sum_probs=16.5

Q ss_pred             ceEEEeceec----cccccEEEEeccc
Q 025155          167 GHISVQGAYL----TYEDTYLAVTGGS  189 (257)
Q Consensus       167 GhISvqGpyl----t~eDtyLAVTGGT  189 (257)
                      .+|-|+||||    ..++.-|+++|=.
T Consensus        16 ~~vlV~GpyLVRsAsv~g~tL~L~GD~   42 (79)
T PF13363_consen   16 NSVLVKGPYLVRSASVSGSTLSLTGDF   42 (79)
T ss_dssp             HB-EEE-SSEEEEEEEETTEEEEEEEB
T ss_pred             CCEEEECCcEEEEEEEcCCEEEEEeec
Confidence            3899999999    4577889988843


No 26 
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed
Probab=31.02  E-value=40  Score=28.90  Aligned_cols=24  Identities=25%  Similarity=0.472  Sum_probs=17.0

Q ss_pred             eEEEeceecc---c--c-ccEEEEecccee
Q 025155          168 HISVQGAYLT---Y--E-DTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt---~--e-DtyLAVTGGTGi  191 (257)
                      .|.|.|||=+   .  + +.++.|.||+||
T Consensus        85 ~v~i~gP~G~~f~l~~~~~~~vlIagG~Gi  114 (250)
T PRK00054         85 ELDIRGPLGNGFDLEEIGGKVLLVGGGIGV  114 (250)
T ss_pred             EEEEEcccCCCCCCCCCCCeEEEEeccccH
Confidence            4667777632   2  2 468999999997


No 27 
>cd06192 DHOD_e_trans_like FAD/NAD binding domain (electron transfer subunit) of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group (as in flavoenzymes) or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD (formi
Probab=29.96  E-value=43  Score=28.35  Aligned_cols=24  Identities=33%  Similarity=0.494  Sum_probs=16.9

Q ss_pred             eEEEeceecc------ccccEEEEecccee
Q 025155          168 HISVQGAYLT------YEDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt------~eDtyLAVTGGTGi  191 (257)
                      .|.|.|||=+      ..+.++.|.||+||
T Consensus        80 ~l~i~gP~G~~~~~~~~~~~~lliagGtGi  109 (243)
T cd06192          80 KLDVMGPLGNGFEGPKKGGTVLLVAGGIGL  109 (243)
T ss_pred             EEEEEccCCCCCccCCCCCEEEEEeCcccH
Confidence            5667777522      13468999999998


No 28 
>cd06213 oxygenase_e_transfer_subunit The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. Electron transfer is from NADH via FAD (in the oxygenase reductase) and an [2FE-2S] ferredoxin center (fused to the FAD/NADH domain and/or discrete) to the oxygenase. Dioxygenases add both atoms of oxygen to the substrate while mono-oxygenases add one atom to the substrate and one atom to water. In dioxygenases, Class I enzymes are 2 component, containing a reductase with  Rieske type [2Fe-2S] redox centers and an oxygenase. Class II are 3 component, having discrete flavin and ferredoxin proteins and an oxygenase. Class III have 2 [2Fe-2S] centers, one fused to the flavin domain and the other separate.
Probab=29.10  E-value=45  Score=27.79  Aligned_cols=12  Identities=42%  Similarity=0.891  Sum_probs=10.8

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus       101 ~~~lliagG~Gi  112 (227)
T cd06213         101 APILCIAGGSGL  112 (227)
T ss_pred             CcEEEEecccch
Confidence            578999999998


No 29 
>PRK08345 cytochrome-c3 hydrogenase subunit gamma; Provisional
Probab=29.08  E-value=45  Score=29.66  Aligned_cols=25  Identities=28%  Similarity=0.534  Sum_probs=17.5

Q ss_pred             eEEEeceecc---cc----ccEEEEeccceee
Q 025155          168 HISVQGAYLT---YE----DTYLAVTGGSGIF  192 (257)
Q Consensus       168 hISvqGpylt---~e----DtyLAVTGGTGiF  192 (257)
                      .|.|.|||=.   ..    +.++.|.||+||=
T Consensus        90 ~v~v~gP~G~~f~~~~~~~~~~llIAgGtGIa  121 (289)
T PRK08345         90 IVGVRGPYGNGFPVDEMEGMDLLLIAGGLGMA  121 (289)
T ss_pred             EEEEeCCCCCCCCcccccCceEEEEecccchh
Confidence            4677777632   21    3689999999984


No 30 
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated
Probab=28.56  E-value=45  Score=29.84  Aligned_cols=25  Identities=16%  Similarity=0.464  Sum_probs=16.6

Q ss_pred             eEEEeceeccc------cccEEEEeccceee
Q 025155          168 HISVQGAYLTY------EDTYLAVTGGSGIF  192 (257)
Q Consensus       168 hISvqGpylt~------eDtyLAVTGGTGiF  192 (257)
                      .|.+.|||=++      .+.++.|.||+||-
T Consensus       187 ~v~v~gP~G~~~~~~~~~~~ivlIagGtGia  217 (339)
T PRK07609        187 ILRIEGPLGTFFLREDSDKPIVLLASGTGFA  217 (339)
T ss_pred             EEEEEcCceeEEecCCCCCCEEEEecCcChh
Confidence            35566665332      23589999999983


No 31 
>cd06215 FNR_iron_sulfur_binding_1 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal portion of the FAD/NAD binding domain contains most of the NADP(H) binding residues and the N-terminal sub-domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. In this ferredoxin like sub-group, the FAD/NAD sub-domains is typically fused to a C-terminal iron-sulfur binding domain. Iron-sulfur pr
Probab=28.51  E-value=48  Score=27.34  Aligned_cols=13  Identities=46%  Similarity=0.733  Sum_probs=11.2

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +.++.|.||+||-
T Consensus       104 ~~~vlIagG~Gia  116 (231)
T cd06215         104 DKLLLLSAGSGIT  116 (231)
T ss_pred             CcEEEEecCcCcc
Confidence            5789999999975


No 32 
>cd06216 FNR_iron_sulfur_binding_2 Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an iron-sulfur binding cluster domain.  Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains.  Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second electron to for
Probab=28.35  E-value=43  Score=28.19  Aligned_cols=13  Identities=38%  Similarity=0.598  Sum_probs=10.9

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +.++.|.||+||=
T Consensus       123 ~~~v~iagG~Gia  135 (243)
T cd06216         123 PRLLLIAAGSGIT  135 (243)
T ss_pred             CCEEEEecCccHh
Confidence            4689999999973


No 33 
>PRK08051 fre FMN reductase; Validated
Probab=27.71  E-value=52  Score=27.82  Aligned_cols=12  Identities=33%  Similarity=0.794  Sum_probs=10.8

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus       103 ~~~vliagG~Gi  114 (232)
T PRK08051        103 RPLLLIAGGTGF  114 (232)
T ss_pred             CcEEEEecCcCc
Confidence            469999999998


No 34 
>PLN02292 ferric-chelate reductase
Probab=27.69  E-value=43  Score=34.89  Aligned_cols=24  Identities=42%  Similarity=0.742  Sum_probs=17.5

Q ss_pred             EEEeceecc------ccccEEEEeccceee
Q 025155          169 ISVQGAYLT------YEDTYLAVTGGSGIF  192 (257)
Q Consensus       169 ISvqGpylt------~eDtyLAVTGGTGiF  192 (257)
                      +.|+|||=.      ..|+.+.|.||+||=
T Consensus       415 V~VeGPYG~~~~~~~~~~~vvlIAGGiGIT  444 (702)
T PLN02292        415 VSVEGPYGPASTDFLRHESLVMVSGGSGIT  444 (702)
T ss_pred             EEEECCccCCccccccCCcEEEEEeccCHH
Confidence            567777642      236899999999983


No 35 
>PRK07823 5'-methylthioadenosine phosphorylase; Validated
Probab=27.48  E-value=50  Score=30.35  Aligned_cols=38  Identities=24%  Similarity=0.260  Sum_probs=26.2

Q ss_pred             EEEEeccceeeeeee-eEEEEEEeeeceeE----EEEEEeccCC
Q 025155          182 YLAVTGGSGIFEGVY-GQVKLHQIVFPYKL----FYTFYLKGVA  220 (257)
Q Consensus       182 yLAVTGGTGiFeGa~-GqVkL~qivfPfkl----fYtFyLkgi~  220 (257)
                      -+||.||||++.-+. +.++ ..+.-||.-    +.-.+|.|.+
T Consensus         7 ~igII~GSGl~~l~~~~~~~-~~~~tpyg~~sg~l~~G~l~g~~   49 (264)
T PRK07823          7 MLGVIGGSGFYSFFGSDARE-VNVDTPYGPPSAPITIGEVGGRR   49 (264)
T ss_pred             eEEEEeccccchhhccccee-eEEeccCCCCCCCEEEEEECCEE
Confidence            689999999998776 4333 456668863    4445677764


No 36 
>smart00797 AHS2 Allophanate hydrolase subunit 2. This domain represents subunit 2 of allophanate hydrolase (AHS2).
Probab=27.32  E-value=62  Score=29.96  Aligned_cols=21  Identities=33%  Similarity=0.659  Sum_probs=14.3

Q ss_pred             EEEeceeccc-cccEEEEeccc
Q 025155          169 ISVQGAYLTY-EDTYLAVTGGS  189 (257)
Q Consensus       169 ISvqGpylt~-eDtyLAVTGGT  189 (257)
                      |+..|+-+.+ +|+++||||+-
T Consensus        33 it~gg~~l~f~~~~~iAitGA~   54 (280)
T smart00797       33 ITLGGPTLRFTADAVIALTGAD   54 (280)
T ss_pred             EecCcEEEEECCCcEEEEeCCC
Confidence            3444665655 78899999864


No 37 
>cd06212 monooxygenase_like The oxygenase reductase FAD/NADH binding domain acts as part of the multi-component bacterial oxygenases which oxidize hydrocarbons. These flavoprotein monooxygenases use molecular oxygen as a substrate and require reduced FAD. One atom of oxygen is incorportated into the aromatic compond, while the other is used to form a molecule of water. In contrast dioxygenases add both atoms of oxygen to the substrate.
Probab=27.29  E-value=49  Score=27.56  Aligned_cols=13  Identities=31%  Similarity=0.613  Sum_probs=11.1

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +..+.|.||+||-
T Consensus       104 ~~~l~iagG~Gia  116 (232)
T cd06212         104 RPIVLIGGGSGMA  116 (232)
T ss_pred             CcEEEEecCcchh
Confidence            4789999999984


No 38 
>PLN02844 oxidoreductase/ferric-chelate reductase
Probab=26.53  E-value=46  Score=34.80  Aligned_cols=23  Identities=39%  Similarity=0.717  Sum_probs=16.3

Q ss_pred             EEEeceeccc------cccEEEEecccee
Q 025155          169 ISVQGAYLTY------EDTYLAVTGGSGI  191 (257)
Q Consensus       169 ISvqGpylt~------eDtyLAVTGGTGi  191 (257)
                      +.|.|||=+.      .|..+-|.||+||
T Consensus       407 v~VeGPYG~~s~~~~~~~~lVLIAGGiGI  435 (722)
T PLN02844        407 VAIEGPYGPASVDFLRYDSLLLVAGGIGI  435 (722)
T ss_pred             EEEECCccCCCCCccCCCeEEEEEcCcCH
Confidence            4555555432      2689999999998


No 39 
>cd06194 FNR_N-term_Iron_sulfur_binding Iron-sulfur binding ferredoxin reductase (FNR) proteins combine the FAD and NAD(P) binding regions of FNR with an N-terminal Iron-Sulfur binding cluster domain. Ferredoxin-NADP+ (oxido)reductase is an FAD-containing enzyme that catalyzes the reversible electron transfer between NADP(H) and electron carrier proteins such as ferredoxin and flavodoxin. Isoforms of these flavoproteins (i.e. having a non-covalently bound FAD as a prosthetic group) are present in chloroplasts, mitochondria, and bacteria in which they participate in a wide variety of redox metabolic pathways. The C-terminal domain contains most of the NADP(H) binding residues and the N-terminal domain interacts non-covalently with the isoalloxazine rings of the flavin molecule which lies largely in a large gap betweed the two domains. Ferredoxin-NADP+ reductase first accepts one electron from reduced ferredoxin to form a flavin semiquinone intermediate. The enzyme then accepts a second e
Probab=26.34  E-value=58  Score=26.87  Aligned_cols=24  Identities=29%  Similarity=0.537  Sum_probs=16.9

Q ss_pred             eEEEeceeccc-------cccEEEEecccee
Q 025155          168 HISVQGAYLTY-------EDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt~-------eDtyLAVTGGTGi  191 (257)
                      .|.|.|||=++       .+..+.|.||+||
T Consensus        79 ~v~i~gP~G~~~~~~~~~~~~~v~iagG~Gi  109 (222)
T cd06194          79 ALRLQGPFGQAFYRPEYGEGPLLLVGAGTGL  109 (222)
T ss_pred             EEEEecCcCCeeccCCCCCCCEEEEecCcch
Confidence            46677776432       2468899999998


No 40 
>TIGR01697 PNPH-PUNA-XAPA inosine guanosine and xanthosine phosphorylase family. Sequences from Clostridium and Thermotoga fall between these last two clades and are uncharacterized with respect to substrate range and operon.
Probab=26.14  E-value=43  Score=29.58  Aligned_cols=36  Identities=28%  Similarity=0.336  Sum_probs=25.6

Q ss_pred             EEEeccceeeeeeeeEEEEEEeeeceeE---------------EEEEEeccCC
Q 025155          183 LAVTGGSGIFEGVYGQVKLHQIVFPYKL---------------FYTFYLKGVA  220 (257)
Q Consensus       183 LAVTGGTGiFeGa~GqVkL~qivfPfkl---------------fYtFyLkgi~  220 (257)
                      ++|.||||+++.. ..+ .+.+.-|++-               ||.-.++|.+
T Consensus         2 ~~ii~gsg~~~~~-~~~-~~~~~~~~~~~p~~~~~~~~~~~~~~~~G~~~g~~   52 (248)
T TIGR01697         2 VAIILGSGLGALA-DQV-EDAVIIPYEKIPGFPVSTVVGHAGELVFGRLGGKP   52 (248)
T ss_pred             EEEEeeCCcchhh-hhc-ccceEeeCccCCCCCCcccCCCCccEEEEEECCEE
Confidence            6899999999966 333 5556667752               8888888753


No 41 
>TIGR02911 sulfite_red_B sulfite reductase, subunit B. Members of this protein family include the B subunit, one of three subunits, of the anaerobic sulfite reductase of Salmonella, and close homologs from various Clostridum species, where the three-gene neighborhood is preserved. Two such gene clusters are found in Clostridium perfringens, but it may be that these sets of genes correspond to the distinct assimilatory and dissimilatory forms as seen in Clostridium pasteurianum.
Probab=25.96  E-value=56  Score=28.60  Aligned_cols=24  Identities=25%  Similarity=0.630  Sum_probs=16.5

Q ss_pred             eEEEeceecc---c----cccEEEEecccee
Q 025155          168 HISVQGAYLT---Y----EDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt---~----eDtyLAVTGGTGi  191 (257)
                      .|.|.|||=+   .    .+.++.|.||+||
T Consensus        81 ~v~i~gP~G~~f~~~~~~~~~~llIAgGtGI  111 (261)
T TIGR02911        81 NLFLRGPYGNGFDVDNYKHKELVVVAGGTGV  111 (261)
T ss_pred             EEEEecCCCCCcccCccCCceEEEEecccCc
Confidence            4566777522   2    2368999999998


No 42 
>PLN02631 ferric-chelate reductase
Probab=25.80  E-value=52  Score=34.35  Aligned_cols=24  Identities=38%  Similarity=0.729  Sum_probs=17.3

Q ss_pred             eEEEeceec----c--ccccEEEEecccee
Q 025155          168 HISVQGAYL----T--YEDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpyl----t--~eDtyLAVTGGTGi  191 (257)
                      .+.|.|||=    +  -.|+.+.|.||+||
T Consensus       395 ~V~VeGPYG~~~~~~~~~~~vVlIAGGsGI  424 (699)
T PLN02631        395 EVSTEGPYGPNSFDVSRHNSLILVSGGSGI  424 (699)
T ss_pred             EEEEECCCCCCCCCcCCCCcEEEEEeCcCh
Confidence            366667773    1  13679999999997


No 43 
>cd06221 sulfite_reductase_like Anaerobic sulfite reductase contains an FAD and NADPH binding module with structural similarity to ferredoxin reductase and sequence similarity to dihydroorotate dehydrogenases. Clostridium pasteurianum inducible dissimilatory type sulfite reductase is linked to ferredoxin and reduces NH2OH and SeO3 at a lesser rate than it's normal substate SO3(2-). Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+.
Probab=25.59  E-value=57  Score=28.23  Aligned_cols=25  Identities=24%  Similarity=0.510  Sum_probs=17.0

Q ss_pred             eEEEeceecc---c----cccEEEEeccceee
Q 025155          168 HISVQGAYLT---Y----EDTYLAVTGGSGIF  192 (257)
Q Consensus       168 hISvqGpylt---~----eDtyLAVTGGTGiF  192 (257)
                      .|.+.|||=+   .    .+..+.|.||+||-
T Consensus        80 ~v~i~gP~G~~f~~~~~~~~~iv~IA~G~Git  111 (253)
T cd06221          80 TVGLRGPFGNGFPVEEMKGKDLLLVAGGLGLA  111 (253)
T ss_pred             EEEEECCcCCCcccccccCCeEEEEccccchh
Confidence            4666666522   1    24689999999973


No 44 
>PLN03116 ferredoxin--NADP+ reductase; Provisional
Probab=25.39  E-value=59  Score=29.26  Aligned_cols=24  Identities=25%  Similarity=0.434  Sum_probs=16.5

Q ss_pred             eEEEeceeccc--------cccEEEEecccee
Q 025155          168 HISVQGAYLTY--------EDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt~--------eDtyLAVTGGTGi  191 (257)
                      .|.|.||+=++        .+..+.|-|||||
T Consensus       137 ~v~v~gP~G~f~~~~~~~~~~~~vlIAgGtGI  168 (307)
T PLN03116        137 KVQITGPSGKVMLLPEEDPNATHIMVATGTGI  168 (307)
T ss_pred             EEEEEEecCCceeCCCCCCCCcEEEEecCccH
Confidence            46777773321        2368999999997


No 45 
>cd06189 flavin_oxioreductase NAD(P)H dependent flavin oxidoreductases use flavin as a substrate in mediating electron transfer from iron complexes or iron proteins. Structurally similar to ferredoxin reductases, but with only 15% sequence identity, flavin reductases reduce FAD, FMN, or riboflavin via NAD(P)H. Flavin is used as a substrate, rather than a tightly bound prosthetic group as in flavoenzymes; weaker binding is due to the absence of a binding site for the AMP moeity of FAD.
Probab=24.51  E-value=56  Score=27.14  Aligned_cols=13  Identities=23%  Similarity=0.644  Sum_probs=11.0

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +.++.|.||+||-
T Consensus        99 ~~ivliagG~Gia  111 (224)
T cd06189          99 RPLILIAGGTGFA  111 (224)
T ss_pred             CCEEEEecCcCHH
Confidence            4689999999983


No 46 
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional
Probab=24.10  E-value=46  Score=27.67  Aligned_cols=20  Identities=30%  Similarity=0.446  Sum_probs=15.7

Q ss_pred             eceeccccccEEEEecccee
Q 025155          172 QGAYLTYEDTYLAVTGGSGI  191 (257)
Q Consensus       172 qGpylt~eDtyLAVTGGTGi  191 (257)
                      |+++++.++....||||+|-
T Consensus         1 ~~~~~~l~~k~vlItG~s~g   20 (266)
T PRK06171          1 MQDWLNLQGKIIIVTGGSSG   20 (266)
T ss_pred             CcccccCCCCEEEEeCCCCh
Confidence            45677788888899999864


No 47 
>cd06188 NADH_quinone_reductase Na+-translocating NADH:quinone oxidoreductase (Na+-NQR) FAD/NADH binding domain. (Na+-NQR) provides a means of storing redox reaction energy via the transmembrane translocation of Na2+ ions. The C-terminal domain resembles ferredoxin:NADP+ oxidoreductase, and has NADH and FAD binding sites. (Na+-NQR) is distinct from H+-translocating NADH:quinone oxidoreductases and noncoupled NADH:quinone oxidoreductases. The NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain of this group typically contains an iron-sulfur cluster binding domain.
Probab=24.03  E-value=63  Score=28.27  Aligned_cols=12  Identities=25%  Similarity=0.675  Sum_probs=10.5

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++.|.||+||
T Consensus       151 ~~~vlIAgGtGI  162 (283)
T cd06188         151 REMVFIGGGAGM  162 (283)
T ss_pred             CcEEEEEecccH
Confidence            468999999998


No 48 
>cd06211 phenol_2-monooxygenase_like Phenol 2-monooxygenase (phenol hydroxylase) is a flavoprotein monooxygenase, able to use molecular oxygen as a substrate in the microbial degredation of phenol. This protein is encoded by a single gene and uses a tightly bound FAD cofactor in the NAD(P)H dependent conversion of phenol and O2 to catechol and H2O. This group is related to the NAD binding ferredoxin reductases.
Probab=23.48  E-value=63  Score=27.18  Aligned_cols=12  Identities=33%  Similarity=0.780  Sum_probs=10.6

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +..+.|.||+||
T Consensus       110 ~~~v~iagG~Gi  121 (238)
T cd06211         110 RPIIFIAGGSGL  121 (238)
T ss_pred             CCEEEEeCCcCH
Confidence            568999999997


No 49 
>PRK13838 conjugal transfer pilin processing protease TraF; Provisional
Probab=23.37  E-value=2.2e+02  Score=24.58  Aligned_cols=44  Identities=32%  Similarity=0.470  Sum_probs=25.6

Q ss_pred             ccccCccccccc---cccccccceeceeeeeE-----EEEeeccCCCCCEEEE
Q 025155          113 LTIGDLVPFTNK---LYTGDLQKRIGITAGLC-----VLIKHEPEKKGDRFEA  157 (257)
Q Consensus       113 nslGDlVpFsNk---LY~g~l~kRiGitaG~C-----vliq~~pek~GdryEa  157 (257)
                      -..||+|-|..+   .++.+.+ |--+..|.|     .+++.+-...||+.+.
T Consensus        51 ~~rGDiVvf~~P~~~~~~~a~~-r~yl~~g~~p~~~~~~iKRViglpGD~V~i  102 (176)
T PRK13838         51 VAVGDLVFICPPETAAFREARE-RGYLRRGLCPGGFAPLIKTVAALAGQRVEI  102 (176)
T ss_pred             CCCCcEEEEECCchhhhhhhhh-cccccccccccCCCceEEEEEEeCCcEEEE
Confidence            467888888632   2332222 223445555     4677777777887763


No 50 
>cd06210 MMO_FAD_NAD_binding Methane monooxygenase (MMO) reductase of methanotrophs catalyzes the NADH-dependent hydroxylation of methane to methanol. This multicomponent enzyme mediates electron transfer via a hydroxylase (MMOH), a coupling protein, and a reductase which is comprised of an N-terminal [2Fe-2S] ferredoxin domain, an FAD binding subdomain, and an NADH binding subdomain. Oxygenases oxidize hydrocarbons using dioxygen as the oxidant. Dioxygenases add both atom of oxygen to the substrate, while mono-oxygenases add one atom to the substrate and one atom to water.
Probab=23.14  E-value=64  Score=26.88  Aligned_cols=12  Identities=33%  Similarity=0.642  Sum_probs=10.3

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +..+-|.||+||
T Consensus       109 ~~~vliagGtGi  120 (236)
T cd06210         109 RPRWFVAGGTGL  120 (236)
T ss_pred             ccEEEEccCcch
Confidence            457889999998


No 51 
>PTZ00319 NADH-cytochrome B5 reductase; Provisional
Probab=22.08  E-value=70  Score=28.83  Aligned_cols=11  Identities=36%  Similarity=0.993  Sum_probs=9.8

Q ss_pred             cEEEEecccee
Q 025155          181 TYLAVTGGSGI  191 (257)
Q Consensus       181 tyLAVTGGTGi  191 (257)
                      .++.|-||+||
T Consensus       168 ~illIAgGtGI  178 (300)
T PTZ00319        168 AFAMIAGGTGI  178 (300)
T ss_pred             eEEEEecCccc
Confidence            58899999998


No 52 
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as NAD binding. NAD(P) binding domain of ferredoxin reductase-like proteins catalyze electron transfer between an NAD(P)-binding domain of the alpha/beta class and a discrete (usually N-terminal) domain which vary in orientation with respect to the NAD(P) binding domain. The N-terminal domain may contain a flavin prosthetic group, as in flavoenzymes, or use flavin as a substrate. Ferredoxin is reduced in the final stage of photosystem I. The flavoprotein Ferredoxin-NADP+ reductase transfers electrons from reduced ferredoxin to FAD,
Probab=21.22  E-value=73  Score=27.39  Aligned_cols=22  Identities=36%  Similarity=0.385  Sum_probs=15.3

Q ss_pred             EEeceeccc-----cccEEEEecccee
Q 025155          170 SVQGAYLTY-----EDTYLAVTGGSGI  191 (257)
Q Consensus       170 SvqGpylt~-----eDtyLAVTGGTGi  191 (257)
                      .+.|||=++     .+..+-|.||+||
T Consensus        83 ~i~gP~G~~~~~~~~~~~lliagG~Gi  109 (248)
T cd06219          83 DVVGPLGKPSEIENYGTVVFVGGGVGI  109 (248)
T ss_pred             eeecCCCCCeecCCCCeEEEEeCcccH
Confidence            466665221     3468999999997


No 53 
>PRK08221 anaerobic sulfite reductase subunit B; Provisional
Probab=21.15  E-value=75  Score=27.86  Aligned_cols=12  Identities=33%  Similarity=0.880  Sum_probs=10.5

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++-|-||+||
T Consensus       102 ~~~llIAgGtGI  113 (263)
T PRK08221        102 KELIVVAGGTGV  113 (263)
T ss_pred             ccEEEEcccccH
Confidence            368999999997


No 54 
>PRK13289 bifunctional nitric oxide dioxygenase/dihydropteridine reductase 2; Provisional
Probab=20.98  E-value=77  Score=28.92  Aligned_cols=24  Identities=17%  Similarity=0.440  Sum_probs=16.1

Q ss_pred             eEEEeceeccc------cccEEEEecccee
Q 025155          168 HISVQGAYLTY------EDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt~------eDtyLAVTGGTGi  191 (257)
                      .|.|.|||=.+      .+.++.|.|||||
T Consensus       244 ~v~v~gP~G~f~l~~~~~~~~vlIagGtGI  273 (399)
T PRK13289        244 VLELAAPAGDFFLDVASDTPVVLISGGVGI  273 (399)
T ss_pred             EEEEEcCccccccCCCCCCcEEEEecCccH
Confidence            45566664322      2368999999997


No 55 
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit. Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation. Although the exact function of this enzyme has not been determined, it has been shown to be required for phenylacetic acid degradation and has been proposed to function in a multicomponent oxygenase acting on phenylacetate-CoA.
Probab=20.84  E-value=67  Score=28.91  Aligned_cols=12  Identities=58%  Similarity=0.991  Sum_probs=10.6

Q ss_pred             ccEEEEecccee
Q 025155          180 DTYLAVTGGSGI  191 (257)
Q Consensus       180 DtyLAVTGGTGi  191 (257)
                      +.++-|.||+||
T Consensus       110 ~~~lliagG~GI  121 (352)
T TIGR02160       110 GHYVAVAAGSGI  121 (352)
T ss_pred             ccEEEEeccccH
Confidence            568999999997


No 56 
>cd06193 siderophore_interacting Siderophore interacting proteins share the domain structure of the ferredoxin reductase like family. Siderophores are produced in various bacteria (and some plants) to extract iron from hosts. Binding constants are high, so iron can be pilfered from transferrin and lactoferrin for bacterial uptake, contributing to pathogen virulence. Ferredoxin reductase (FNR), an FAD and NAD(P) binding protein, was intially identified as a chloroplast reductase activity, catalyzing the electron transfer from reduced iron-sulfur protein ferredoxin to NADP+ as the final step in the electron transport mechanism of photosystem I. FNR transfers electrons from reduced ferredoxin to FAD (forming FADH2 via a semiquinone intermediate) and then transfers a hydride ion to convert NADP+ to NADPH. FNR has since been shown to utilize a variety of electron acceptors and donors and has a variety of physiological functions including nitrogen assimilation, dinitrogen fixation, steroid hy
Probab=20.77  E-value=77  Score=26.96  Aligned_cols=24  Identities=17%  Similarity=0.360  Sum_probs=17.0

Q ss_pred             eEEEeceeccc-----cccEEEEecccee
Q 025155          168 HISVQGAYLTY-----EDTYLAVTGGSGI  191 (257)
Q Consensus       168 hISvqGpylt~-----eDtyLAVTGGTGi  191 (257)
                      .|.+.||+=++     .+.++.|-|||||
T Consensus       104 ~v~v~gP~G~~~~~~~~~~~vlia~GtGi  132 (235)
T cd06193         104 TLGIAGPGGSFLPPPDADWYLLAGDETAL  132 (235)
T ss_pred             EEEEECCCCCCCCCCCcceEEEEeccchH
Confidence            56666665444     2358999999997


No 57 
>cd06218 DHOD_e_trans FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase. Dihydroorotate dehydrogenases (DHODs) catalyze the only redox reaction in pyrimidine de novo biosynthesis. They catalyze the oxidation of (S)-dihydroorotate to orotate coupled with the reduction of NAD+. In L. lactis, DHOD B (encoded by pyrDa) is co-expressed with pyrK and both gene products are required for full activity, as well as 3 cofactors: FMN, FAD, and an [2Fe-2S] cluster.
Probab=20.52  E-value=81  Score=27.16  Aligned_cols=13  Identities=46%  Similarity=0.613  Sum_probs=10.9

Q ss_pred             ccEEEEeccceee
Q 025155          180 DTYLAVTGGSGIF  192 (257)
Q Consensus       180 DtyLAVTGGTGiF  192 (257)
                      +..+-|.|||||=
T Consensus        99 ~~~vlIagGtGIa  111 (246)
T cd06218          99 GKVLLVGGGIGIA  111 (246)
T ss_pred             CcEEEEecccCHH
Confidence            4689999999983


No 58 
>PF02141 DENN:  DENN (AEX-3) domain;  InterPro: IPR001194 The human serine- and leucine-rich DENN protein possesses a RGD cellular adhesion motif and a leucine-zipper-like motif associated with protein dimerization, and shows partial homology to the receptor binding domain of tumor necrosis factor alpha. DENN is virtually identical to MADD, a human MAP kinase-activating death domain protein that interacts with type I tumor necrosis factor receptor. DENN displays significant homology to Rab3 GEP, a rat GDP/GTP exchange protein specific for Rab3 small G proteins implicated in intracellular vesicle trafficking. DENN also exhibits strong similarity to Caenorhabditis elegans AEX-3, which interacts with Rab3 to regulate synaptic vesicle release []. The DENN domain is always encircled on both sides by more divergent domains, known as uDENN (IPR005113 from INTERPRO) and dDENN (IPR005112 from INTERPRO), which could play a key role in DENN function.; PDB: 3TW8_A.
Probab=20.46  E-value=16  Score=30.19  Aligned_cols=31  Identities=26%  Similarity=0.575  Sum_probs=17.1

Q ss_pred             EEEeeeceeEEEEEEeccCCCChhhhhcCCCCCCC
Q 025155          201 LHQIVFPYKLFYTFYLKGVADLPQELLVKPVEPSP  235 (257)
Q Consensus       201 L~qivfPfklfYtFyLkgi~dlp~el~~~~v~ps~  235 (257)
                      +.++++||+|-..|    ||-||.+|+.---.|.|
T Consensus       127 l~~ll~Pf~w~~~~----ip~LP~~l~~~l~aP~P  157 (185)
T PF02141_consen  127 LLSLLYPFQWQHVY----IPVLPPSLLDYLEAPTP  157 (185)
T ss_dssp             HHHTTTTS---SEE----ESS--GGGGGGGG-SS-
T ss_pred             HHHHccCcccCceE----EeecCHHHHhhcCCCCC
Confidence            46788888888887    78888877665544443


Done!