Query         025156
Match_columns 257
No_of_seqs    187 out of 889
Neff          4.7 
Searched_HMMs 46136
Date          Fri Mar 29 03:11:57 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025156.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025156hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02365 NAM:  No apical merist  99.9   8E-25 1.7E-29  178.1   4.7   86    2-87     42-129 (129)
  2 PF01473 CW_binding_1:  Putativ  17.2      87  0.0019   17.3   1.2    8   15-22      7-14  (19)
  3 KOG2675 Adenylate cyclase-asso  15.5   1E+02  0.0022   31.3   2.0   13   77-89    171-183 (480)
  4 PF15471 TMEM171:  Transmembran  12.8 1.6E+02  0.0034   28.3   2.4   13  103-115   176-188 (319)
  5 KOG4280 Kinesin-like protein [   9.6 1.4E+02  0.0031   31.0   1.1   19  185-207   203-221 (574)
  6 PRK04235 hypothetical protein;   8.9 1.6E+02  0.0034   26.4   0.9   16  181-196    36-51  (196)
  7 COG3350 Uncharacterized conser   7.5 2.5E+02  0.0055   20.4   1.3   18    5-23     15-32  (53)
  8 KOG4816 Uncharacterized conser   6.8 2.2E+02  0.0047   23.0   0.7   16  176-192    10-25  (98)
  9 PF14983 DUF4513:  Domain of un   6.8 3.1E+02  0.0068   23.2   1.7   33  178-212     4-37  (132)
 10 COG3100 Uncharacterized protei   6.5 3.2E+02   0.007   22.3   1.6   17  103-119     9-25  (103)

No 1  
>PF02365 NAM:  No apical meristem (NAM) protein;  InterPro: IPR003441 The NAC domain (for Petunia hybrida (Petunia) NAM and for Arabidopsis ATAF1, ATAF2, and CUC2) is an N-terminal module of ~160 amino acids, which is found in proteins of the NAC family of plant-specific transcriptional regulators (no apical meristem (NAM) proteins) []. NAC proteins are involved in developmental processes, including formation of the shoot apical meristem, floral organs and lateral shoots, as well as in plant hormonal control and defence. The NAC domain is accompanied by diverse C-terminal transcriptional activation domains. The NAC domain has been shown to be a DNA-binding domain (DBD) and a dimerization domain [,]. The NAC domain can be subdivided into five subdomains (A-E). Each subdomain is distinguishable by blocks of heterogeneous amino acids or gaps. While the NAC domains were rich in basic amino acids (R, K and H) as a whole, the distribution of positive and negative amino acids in each subdomain were unequal. Subdomains C and D are rich in basic amino acids but poor in acidic amino acids, while subdomain B contains a high proportion of acidic amino acids. Putative nuclear localization signals (NLS) have been detected in subdomains C and D []. The DBD is contained within a 60 amino acid region located within subdomains D and E []. The overall structure of the NAC domain monomer consists of a very twisted antiparallel beta-sheet, which packs against an N-terminal alpha-helix on one side and one shorter helix on the other side surrounded by a few helical elements. The structure suggests that the NAC domain mediates dimerization through conserved interactions including a salt bridge, and DNA binding through the NAC dimer face rich in positive charges [].; GO: 0003677 DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 1UT4_A 3SWM_B 4DUL_B 3SWP_D 1UT7_B 3ULX_A.
Probab=99.90  E-value=8e-25  Score=178.14  Aligned_cols=86  Identities=56%  Similarity=1.122  Sum_probs=64.5

Q ss_pred             CCcccccccccCCCceEEEeccCCCCCCCCCCCcccccCccccccCCccccc--CCcceEEEEEEeeeeccCCCCcccCe
Q 025156            2 IFIREISDLALYGEKEWYFFTPRDRKYPNGSRPNRAAGSGYWKATGADKPIG--QPKPVGIKKALVFYAGKAPKGEKTNW   79 (257)
Q Consensus         2 ~~P~dLPg~al~gekeWYFFSpr~rKy~nG~R~nRatg~GyWK~tG~~k~I~--~gk~VG~KKtLvFY~Gk~p~g~KT~W   79 (257)
                      .+||+||+....++++||||+++.+++.+|.|.+|++++|+||.+|++++|.  ++++||+|++|+||.++.+++.+|+|
T Consensus        42 ~~P~~L~~~~~~~~~~~yFF~~~~~~~~~~~r~~R~~~~G~Wk~~g~~~~i~~~~g~~iG~k~~l~f~~~~~~~~~kt~W  121 (129)
T PF02365_consen   42 AHPWELPAKFKGGDEEWYFFSPRKKKYPNGGRPNRVTGGGYWKSTGKEKPIKDPGGKVIGFKKTLVFYSGKSPNGKKTGW  121 (129)
T ss_dssp             S-GGGCHHHSSS-SSEEEEEEE----------S-EEETTEEEEEECEEEEEEE-TTCEEEEEEEEEEEESSTTS-EEEEE
T ss_pred             cChHHhhhhccCCCceEEEEEecccccCCcccccccccceEEeecccccccccccceeeeeEEEEEEEeccCCCCCcCCe
Confidence            4799999543446779999999999999999999999999999999999996  57899999999999998899999999


Q ss_pred             EEeEEEec
Q 025156           80 IMHEYRLA   87 (257)
Q Consensus        80 vMhEYrL~   87 (257)
                      +||||+|.
T Consensus       122 ~M~EY~L~  129 (129)
T PF02365_consen  122 VMHEYSLE  129 (129)
T ss_dssp             EEEEEEE-
T ss_pred             EEEEEEeC
Confidence            99999983


No 2  
>PF01473 CW_binding_1:  Putative cell wall binding repeat;  InterPro: IPR018337 The cell wall-binding repeat (CW) is an about 20 amino acid residue module, essentially found in two bacterial Gram-positive protein families; the choline binding proteins and glucosyltransferases (2.4.1.5 from EC). In choline-binding proteins cell wall binding repeats bind to choline moieties of both teichoic and lipoteichoic acids, two components peculiar to the cell surface of Gram-positive bacteria [, ]. In glucosyltransferases the region spanning the CW repeats is a glucan binding domain []. Several crystal structures of CW have been solved [, ]. In the choline binding protein LytA, the repeats adopt a solenoid fold consisting exclusively of beta-hairpins that stack to form a left-handed superhelix with a boomerang-like shape. The choline groups bind between beta-hairpin 'steps' of the superhelix []. In Cpl-1 CW repeats assemble in two sub-domains: an N-terminal superhelical moiety similar to the LytA one and a C-terminal beta-sheet involved in interactions with the lysozyme domain. Choline is bound between repeats 1 and 2, and, 2 and 3 of the superhelical sub-domain []. Some proteins known to contain cell-wall binding repeats include:  Pneumococcal N-acetylmuramoyl-L-alanine amidase (autolysin, lytA) (3.5.1.28 from EC). It is a surface-exposed enzyme that rules the self-destruction of pneumococcal cells through degradation of their peptidoglycan backbone. It mediates the release of toxic substances that damage the host tissues. Pneumococcal endo-beta-N-acetylglucosaminidase (lytB) (3.2.1.96 from EC). It plays an important role in cell wall degradation and cell separation. Pneumococcal teichoic acid phosphorylcholine esterase (pce or cbpE), a cell wall hydrolase important for cellular adhesion and colonisation. Lactobacillales glucosyltransferase. It catalyses the transfer of glucosyl units from the cleavage of sucrose to a growing chain of glucan.  Clostridium difficile toxin A (tcdA) and toxin B (tcdb). They are the causative agents of the antibiotic-associated pseudomembranous colitis. They are intracellular acting toxins that reach their targets after receptor-mediated endocytosis.  Clostridium acetobutylicum cspA protein. Siphoviridae bacteriophages N-acetylmuramoyl-L-alanine amidase. It lyses the bacterial host cell wall. Podoviridae lysozyme protein (cpl-1). It is capable of digesting the pneumococcal cell wall.  The cell wall binding repeats are also known as the choline-binding repeats (ChBr) or the choline-binding domain (ChBD). ; PDB: 1GVM_C 2BML_B 1HCX_A 1OBA_A 1H09_A 2J8F_A 2IXU_A 2J8G_A 2IXV_A 2X8O_A ....
Probab=17.23  E-value=87  Score=17.33  Aligned_cols=8  Identities=38%  Similarity=1.448  Sum_probs=6.4

Q ss_pred             CceEEEec
Q 025156           15 EKEWYFFT   22 (257)
Q Consensus        15 ekeWYFFS   22 (257)
                      ++.||||.
T Consensus         7 ~~~wYy~~   14 (19)
T PF01473_consen    7 NGNWYYFD   14 (19)
T ss_dssp             TTEEEEET
T ss_pred             CCEEEEeC
Confidence            47899995


No 3  
>KOG2675 consensus Adenylate cyclase-associated protein (CAP/Srv2p) [Cytoskeleton; Signal transduction mechanisms]
Probab=15.51  E-value=1e+02  Score=31.29  Aligned_cols=13  Identities=38%  Similarity=0.642  Sum_probs=7.3

Q ss_pred             cCeEEeEEEecCc
Q 025156           77 TNWIMHEYRLADV   89 (257)
Q Consensus        77 T~WvMhEYrL~~~   89 (257)
                      ||=+|.||+=.+.
T Consensus       171 ~NrvLkEyk~~D~  183 (480)
T KOG2675|consen  171 TNRVLKEYKEKDP  183 (480)
T ss_pred             HHHHHHHhccCCh
Confidence            4456667765443


No 4  
>PF15471 TMEM171:  Transmembrane protein family 171
Probab=12.76  E-value=1.6e+02  Score=28.31  Aligned_cols=13  Identities=8%  Similarity=0.232  Sum_probs=8.3

Q ss_pred             CeEEEEEEeeCCC
Q 025156          103 DWVLCRIYNKKGS  115 (257)
Q Consensus       103 dwVLCRIy~Kk~~  115 (257)
                      =+||-+|.||..-
T Consensus       176 FFVVAHvKKr~nl  188 (319)
T PF15471_consen  176 FFVVAHVKKRNNL  188 (319)
T ss_pred             hhheeeeeeccCC
Confidence            4688888665433


No 5  
>KOG4280 consensus Kinesin-like protein [Cytoskeleton]
Probab=9.65  E-value=1.4e+02  Score=31.03  Aligned_cols=19  Identities=42%  Similarity=0.679  Sum_probs=15.9

Q ss_pred             ccccCCCCcceecCCCccceecc
Q 025156          185 KLNTDSSCSEHVVSPEFTCEVQS  207 (257)
Q Consensus       185 ~~~~dss~~~~~~s~~~~~~v~s  207 (257)
                      .+|.+||.| |++   |||.|.|
T Consensus       203 ~mn~~SsRS-H~i---ft~~i~~  221 (574)
T KOG4280|consen  203 SMNEESSRS-HAI---FTIHIES  221 (574)
T ss_pred             cCCcccccc-eEE---EEEEEEe
Confidence            456689999 999   9999888


No 6  
>PRK04235 hypothetical protein; Provisional
Probab=8.92  E-value=1.6e+02  Score=26.43  Aligned_cols=16  Identities=38%  Similarity=0.594  Sum_probs=13.0

Q ss_pred             CCCcccccCCCCccee
Q 025156          181 DSVPKLNTDSSCSEHV  196 (257)
Q Consensus       181 ~s~p~~~~dss~~~~~  196 (257)
                      -|.|.+-|.||||-.|
T Consensus        36 Ns~~~~~TTSSCSGRI   51 (196)
T PRK04235         36 NSLKNYYTTSSCSGRI   51 (196)
T ss_pred             hCCCCeEEccCCcceE
Confidence            3778888999999755


No 7  
>COG3350 Uncharacterized conserved protein [Function unknown]
Probab=7.47  E-value=2.5e+02  Score=20.42  Aligned_cols=18  Identities=28%  Similarity=0.580  Sum_probs=10.5

Q ss_pred             ccccccccCCCceEEEecc
Q 025156            5 REISDLALYGEKEWYFFTP   23 (257)
Q Consensus         5 ~dLPg~al~gekeWYFFSp   23 (257)
                      ..-.-+..|++++ ||||-
T Consensus        15 ~~a~~k~~Y~Gkt-YYFcs   32 (53)
T COG3350          15 ENAEYKSSYGGKT-YYFCS   32 (53)
T ss_pred             cccceeEEeCCEE-EEEeC
Confidence            3344455677777 55664


No 8  
>KOG4816 consensus Uncharacterized conserved protein [Function unknown]
Probab=6.83  E-value=2.2e+02  Score=22.97  Aligned_cols=16  Identities=25%  Similarity=0.694  Sum_probs=11.4

Q ss_pred             cccCCCCCcccccCCCC
Q 025156          176 YFDTSDSVPKLNTDSSC  192 (257)
Q Consensus       176 ~~~~s~s~p~~~~dss~  192 (257)
                      -||.| -+-|+|.||-|
T Consensus        10 vynks-NFSrfh~dsvc   25 (98)
T KOG4816|consen   10 VYNKS-NFSRFHPDSVC   25 (98)
T ss_pred             ccCcc-cccccCCCCcc
Confidence            35666 56688888888


No 9  
>PF14983 DUF4513:  Domain of unknown function (DUF4513)
Probab=6.83  E-value=3.1e+02  Score=23.18  Aligned_cols=33  Identities=30%  Similarity=0.557  Sum_probs=22.1

Q ss_pred             cCCCCCcccccCCCCcc-eecCCCccceeccccccc
Q 025156          178 DTSDSVPKLNTDSSCSE-HVVSPEFTCEVQSEPKMQ  212 (257)
Q Consensus       178 ~~s~s~p~~~~dss~~~-~~~s~~~~~~v~s~p~~~  212 (257)
                      ||--.+|+|  .++||+ ..--|...||+|.-|.|+
T Consensus         4 dt~p~~pkl--~~~~s~e~~~k~~~k~~~iHlPrFS   37 (132)
T PF14983_consen    4 DTCPTLPKL--TNNCSDENSYKPANKYEEIHLPRFS   37 (132)
T ss_pred             CcCCcCccc--ccccccccccCCcccccccccchhh
Confidence            455577888  477774 333445567888888875


No 10 
>COG3100 Uncharacterized protein conserved in bacteria [Function unknown]
Probab=6.53  E-value=3.2e+02  Score=22.30  Aligned_cols=17  Identities=24%  Similarity=0.366  Sum_probs=12.7

Q ss_pred             CeEEEEEEeeCCCCccc
Q 025156          103 DWVLCRIYNKKGSIEKQ  119 (257)
Q Consensus       103 dwVLCRIy~Kk~~~ek~  119 (257)
                      --.||-||+++++..-+
T Consensus         9 ~~mlCaIYkS~kk~~tY   25 (103)
T COG3100           9 KSMLCAIYKSPKKDGTY   25 (103)
T ss_pred             eeeeeeeeecCcCCccE
Confidence            35799999887766554


Done!