Citrus Sinensis ID: 025158
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 257 | ||||||
| 297739793 | 350 | unnamed protein product [Vitis vinifera] | 0.887 | 0.651 | 0.768 | 1e-99 | |
| 225441543 | 353 | PREDICTED: F-box protein At3g58530 [Viti | 0.887 | 0.645 | 0.768 | 2e-99 | |
| 255580692 | 351 | ubiquitin-protein ligase, putative [Rici | 0.879 | 0.643 | 0.733 | 2e-97 | |
| 224088164 | 341 | predicted protein [Populus trichocarpa] | 0.731 | 0.551 | 0.768 | 6e-97 | |
| 147789108 | 349 | hypothetical protein VITISV_044261 [Viti | 0.887 | 0.653 | 0.764 | 9e-94 | |
| 297817168 | 353 | hypothetical protein ARALYDRAFT_486305 [ | 0.887 | 0.645 | 0.698 | 3e-86 | |
| 18410977 | 353 | F-box protein [Arabidopsis thaliana] gi| | 0.696 | 0.507 | 0.7 | 7e-82 | |
| 15450960 | 353 | putative protein [Arabidopsis thaliana] | 0.696 | 0.507 | 0.7 | 7e-82 | |
| 356530677 | 353 | PREDICTED: F-box protein At3g58530-like | 0.871 | 0.634 | 0.640 | 2e-80 | |
| 242061336 | 349 | hypothetical protein SORBIDRAFT_04g01103 | 0.813 | 0.598 | 0.625 | 5e-78 |
| >gi|297739793|emb|CBI29975.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 369 bits (946), Expect = 1e-99, Method: Compositional matrix adjust.
Identities = 176/229 (76%), Positives = 207/229 (90%), Gaps = 1/229 (0%)
Query: 3 MEEEKVKAAEEEETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVI 62
MEE + +A + + WS+ET+PKV+RI+ TRL QRD+ISLLLVSPW+HRTLVS SLWLV+
Sbjct: 1 MEETEARAGGDLK-WSRETIPKVLRIVGTRLPQRDLISLLLVSPWIHRTLVSCSSLWLVL 59
Query: 63 DLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLN 122
D RE NNAGNRLVAALS+ RY+HV++INLEFAQDIED+HL+LLKTKCL SLQ+LESLNLN
Sbjct: 60 DFRETNNAGNRLVAALSLFRYQHVKQINLEFAQDIEDKHLDLLKTKCLDSLQELESLNLN 119
Query: 123 GCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDK 182
CQKISD+G+E I+S CP+LKVFSIYWNVRVTDIG+ HLVKNCKHI+DLNLSGCKN+ DK
Sbjct: 120 VCQKISDRGVETITSACPKLKVFSIYWNVRVTDIGMTHLVKNCKHIVDLNLSGCKNITDK 179
Query: 183 SLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGY 231
SLQLIADNY +LE LNLTRC+KLTDGGLQ+IL+KCSSL+SLNLYALS +
Sbjct: 180 SLQLIADNYPDLELLNLTRCIKLTDGGLQQILLKCSSLQSLNLYALSSF 228
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|225441543|ref|XP_002276459.1| PREDICTED: F-box protein At3g58530 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|255580692|ref|XP_002531168.1| ubiquitin-protein ligase, putative [Ricinus communis] gi|223529238|gb|EEF31211.1| ubiquitin-protein ligase, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|224088164|ref|XP_002308350.1| predicted protein [Populus trichocarpa] gi|222854326|gb|EEE91873.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|147789108|emb|CAN73494.1| hypothetical protein VITISV_044261 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|297817168|ref|XP_002876467.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] gi|297322305|gb|EFH52726.1| hypothetical protein ARALYDRAFT_486305 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|18410977|ref|NP_567069.1| F-box protein [Arabidopsis thaliana] gi|75154905|sp|Q8LB33.1|FB330_ARATH RecName: Full=F-box protein At3g58530 gi|21593045|gb|AAM64994.1| unknown [Arabidopsis thaliana] gi|332646275|gb|AEE79796.1| F-box protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|15450960|gb|AAK96751.1| putative protein [Arabidopsis thaliana] gi|17978711|gb|AAL47349.1| putative protein [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|356530677|ref|XP_003533907.1| PREDICTED: F-box protein At3g58530-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|242061336|ref|XP_002451957.1| hypothetical protein SORBIDRAFT_04g011030 [Sorghum bicolor] gi|241931788|gb|EES04933.1| hypothetical protein SORBIDRAFT_04g011030 [Sorghum bicolor] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 257 | ||||||
| TAIR|locus:2076376 | 353 | AT3G58530 [Arabidopsis thalian | 0.840 | 0.611 | 0.694 | 3.7e-80 | |
| WB|WBGene00015350 | 466 | C02F5.7 [Caenorhabditis elegan | 0.525 | 0.289 | 0.333 | 1.3e-16 | |
| TAIR|locus:2027082 | 360 | SKP2A [Arabidopsis thaliana (t | 0.571 | 0.408 | 0.339 | 9.7e-16 | |
| UNIPROTKB|F1PWK1 | 422 | FBXL2 "Uncharacterized protein | 0.536 | 0.327 | 0.323 | 5.9e-15 | |
| RGD|1562243 | 422 | Fbxl2 "F-box and leucine-rich | 0.618 | 0.376 | 0.298 | 7.5e-15 | |
| MGI|MGI:1919429 | 423 | Fbxl2 "F-box and leucine-rich | 0.618 | 0.375 | 0.298 | 7.6e-15 | |
| ZFIN|ZDB-GENE-040426-2440 | 310 | fbxl15 "F-box and leucine-rich | 0.552 | 0.458 | 0.284 | 1.5e-14 | |
| UNIPROTKB|Q9UKC9 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.536 | 0.326 | 0.316 | 1.6e-14 | |
| UNIPROTKB|Q5R3Z8 | 423 | FBXL2 "F-box/LRR-repeat protei | 0.536 | 0.326 | 0.316 | 1.6e-14 | |
| UNIPROTKB|F1NHD2 | 423 | FBXL2 "Uncharacterized protein | 0.536 | 0.326 | 0.302 | 2.1e-14 |
| TAIR|locus:2076376 AT3G58530 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 805 (288.4 bits), Expect = 3.7e-80, P = 3.7e-80
Identities = 150/216 (69%), Positives = 186/216 (86%)
Query: 16 TWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLV 75
TW +E V V+R++STRL Q D+ISLLLVSPWL+RTL+SYPS+WL I+LREM NAG+RL+
Sbjct: 13 TWRREIVTSVMRLVSTRLPQTDLISLLLVSPWLYRTLISYPSIWLTINLREMTNAGDRLL 72
Query: 76 AALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEII 135
AALS+PRYR V+ INLEFAQ + D HL+L+KT+C +L LE LNLN CQKISD GIE I
Sbjct: 73 AALSLPRYRQVKHINLEFAQGVVDSHLKLVKTECPDALLSLEWLNLNVCQKISDNGIEAI 132
Query: 136 SSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQELE 195
+S CP+LKVFSIYWNVRVTD GI++LVKNC+HI DLNLSGCK+L DKS+QL+A++Y +LE
Sbjct: 133 TSICPKLKVFSIYWNVRVTDAGIRNLVKNCRHITDLNLSGCKSLTDKSMQLVAESYPDLE 192
Query: 196 SLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGY 231
SLN+TRCVK+TD GL ++L KC SL++LNLYALSG+
Sbjct: 193 SLNITRCVKITDDGLLQVLQKCFSLQTLNLYALSGF 228
|
|
| WB|WBGene00015350 C02F5.7 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2027082 SKP2A [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PWK1 FBXL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| RGD|1562243 Fbxl2 "F-box and leucine-rich repeat protein 2" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1919429 Fbxl2 "F-box and leucine-rich repeat protein 2" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-040426-2440 fbxl15 "F-box and leucine-rich repeat protein 15" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UKC9 FBXL2 "F-box/LRR-repeat protein 2" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5R3Z8 FBXL2 "F-box/LRR-repeat protein 2" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NHD2 FBXL2 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| GSVIVG00025432001 | SubName- Full=Chromosome chr8 scaffold_34, whole genome shotgun sequence; (353 aa) | |||||||
(Vitis vinifera) | ||||||||
| Sorry, there are no predicted associations at the current settings. |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 257 | |||
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 7e-14 | |
| cd09293 | 226 | cd09293, AMN1, Antagonist of mitotic exit network | 7e-13 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Score = 68.5 bits (168), Expect = 7e-14
Identities = 40/148 (27%), Positives = 74/148 (50%), Gaps = 11/148 (7%)
Query: 84 RHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELK 143
++++ L ++ I+D L L C L+ L+L C+ I+D GI +++ CP+L+
Sbjct: 52 NKLKKLILPGSKLIDDEGLIALAQSCPN----LQVLDLRACENITDSGIVALATNCPKLQ 107
Query: 144 VFSIYWNVR---VTDIGIQHLVKNCKHIIDLNLSGCKNLLDKSL-QLIADNYQELESLNL 199
++ + +TD+ + L KNC + + +GC ++ DK + +L + + LE L+L
Sbjct: 108 TINLGRHRNGHLITDVSLSALGKNCTFLQTVGFAGC-DVTDKGVWELASGCSKSLERLSL 166
Query: 200 TRCVKLTDGGLQKILIK--CSSLRSLNL 225
C LTD + IL +L L
Sbjct: 167 NNCRNLTDQSIPAILASNYFPNLSVLEF 194
|
Amn1 has been functionally characterized in Saccharomyces cerevisiae as a component of the Antagonist of MEN pathway (AMEN). The AMEN network is activated by MEN (mitotic exit network) via an active Cdc14, and in turn switches off MEN. Amn1 constitutes one of the alternative mechanisms by which MEN may be disrupted. Specifically, Amn1 binds Tem1 (Termination of M-phase, a GTPase that belongs to the RAS superfamily), and disrupts its association with Cdc15, the primary downstream target. Amn1 is a leucine-rich repeat (LRR) protein, with 12 repeats in the S. cerevisiae ortholog. As a negative regulator of the signal transduction pathway MEN, overexpression of AMN1 slows the growth of wild type cells. The function of the vertebrate members of this family has not been determined experimentally, they have fewer LRRs that determine the extent of this model. Length = 226 |
| >gnl|CDD|187754 cd09293, AMN1, Antagonist of mitotic exit network protein 1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 257 | |||
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.94 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.9 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 99.79 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 99.66 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.52 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.47 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 99.43 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.4 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.04 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.99 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.94 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 98.91 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 98.9 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.8 | |
| PF12937 | 47 | F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B | 98.79 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.75 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 98.75 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.65 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.51 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 98.47 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.34 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 98.3 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.26 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 98.21 | |
| smart00256 | 41 | FBOX A Receptor for Ubiquitination Targets. | 98.16 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.03 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 97.94 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.93 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.84 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 97.82 | |
| PF00646 | 48 | F-box: F-box domain; InterPro: IPR001810 The F-box | 97.81 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 97.75 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.62 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.43 | |
| smart00367 | 26 | LRR_CC Leucine-rich repeat - CC (cysteine-containi | 97.41 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 97.33 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.31 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 97.29 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 97.28 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.22 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.21 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 97.17 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 97.14 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 97.14 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 97.07 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 96.74 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.64 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 96.64 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.45 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 96.35 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 96.23 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.86 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 95.83 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.69 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.68 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 95.66 | |
| KOG0281 | 499 | consensus Beta-TrCP (transducin repeats containing | 95.65 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 95.57 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.4 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 95.4 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 95.39 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.38 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 95.34 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 95.31 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 94.84 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 94.11 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 93.47 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 93.38 | |
| KOG2997 | 366 | consensus F-box protein FBX9 [General function pre | 93.24 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 93.0 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 92.99 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 92.93 | |
| PLN03215 | 373 | ascorbic acid mannose pathway regulator 1; Provisi | 92.33 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 92.06 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 91.48 | |
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 91.43 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 91.11 | |
| KOG3763 | 585 | consensus mRNA export factor TAP/MEX67 [RNA proces | 90.06 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 89.92 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 89.44 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 87.83 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 87.21 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 86.77 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 83.37 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 80.67 |
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
Probab=99.94 E-value=1.9e-27 Score=192.30 Aligned_cols=228 Identities=21% Similarity=0.363 Sum_probs=156.5
Q ss_pred cCcHHHHHHHHcCCChhhhHHHHhhcHHHHHHHhcCCCCceEeecccccchhhH-HHHHhcCccC-CCccEEeccCCCCC
Q 025158 20 ETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNR-LVAALSIPRY-RHVREINLEFAQDI 97 (257)
Q Consensus 20 ~~~pe~l~~If~~L~~~~l~~~~~v~~~w~~~~~~~~~~~~~l~l~~~~~~~~~-~~~~~~~~~~-~~L~~L~l~~~~~~ 97 (257)
.+|||++..||++|+.+.+.+++++|+.|... +.++..|+++|+.......+. ++..++ .++ ..|++|.+.++..+
T Consensus 74 ~LPpEl~lkvFS~LDtksl~r~a~~c~~~n~~-AlD~~~~q~idL~t~~rDv~g~VV~~~~-~Rcgg~lk~LSlrG~r~v 151 (483)
T KOG4341|consen 74 SLPPELLLKVFSMLDTKSLCRAAQCCTMWNKL-ALDGSCWQHIDLFTFQRDVDGGVVENMI-SRCGGFLKELSLRGCRAV 151 (483)
T ss_pred cCCHHHHHHHHHHHhHHHHHHHHHHHHHhhhh-hhccccceeeehhcchhcCCCcceehHh-hhhccccccccccccccC
Confidence 55789999999999999999999999999765 999999999999887554322 223332 222 35667777776666
Q ss_pred chHHHHHHHHhccCCCCCccEEecCCCCCCChHHHHHHHhcCCCCcEEEecCCcccCHHHHHHHHHcCCCCCEEeccCCC
Q 025158 98 EDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLVKNCKHIIDLNLSGCK 177 (257)
Q Consensus 98 ~~~~l~~l~~~~~~~~~~L~~L~L~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~~L~~L~l~~~~ 177 (257)
.+..+..+...| |++++|.+.+|..+++..+..+++.|+.|++|.+..|..+++..+..+++.|++|++|+++.|+
T Consensus 152 ~~sslrt~~~~C----pnIehL~l~gc~~iTd~s~~sla~~C~~l~~l~L~~c~~iT~~~Lk~la~gC~kL~~lNlSwc~ 227 (483)
T KOG4341|consen 152 GDSSLRTFASNC----PNIEHLALYGCKKITDSSLLSLARYCRKLRHLNLHSCSSITDVSLKYLAEGCRKLKYLNLSWCP 227 (483)
T ss_pred CcchhhHHhhhC----CchhhhhhhcceeccHHHHHHHHHhcchhhhhhhcccchhHHHHHHHHHHhhhhHHHhhhccCc
Confidence 666666666554 6777777777766677666666667777777777666666776666666677777777766666
Q ss_pred CCCHHHHHHHHhhCCC--------------------------CCEEeccCCCCCCHHHHHHHHhcCCCCCeEecCCCCCC
Q 025158 178 NLLDKSLQLIADNYQE--------------------------LESLNLTRCVKLTDGGLQKILIKCSSLRSLNLYALSGY 231 (257)
Q Consensus 178 ~l~~~~l~~l~~~~~~--------------------------L~~L~l~~~~~l~~~~l~~l~~~~~~L~~L~l~~c~~~ 231 (257)
.+++.++..+.+++.. +-.+++..|..+||+++..+..+|.+|+.|+.++|..+
T Consensus 228 qi~~~gv~~~~rG~~~l~~~~~kGC~e~~le~l~~~~~~~~~i~~lnl~~c~~lTD~~~~~i~~~c~~lq~l~~s~~t~~ 307 (483)
T KOG4341|consen 228 QISGNGVQALQRGCKELEKLSLKGCLELELEALLKAAAYCLEILKLNLQHCNQLTDEDLWLIACGCHALQVLCYSSCTDI 307 (483)
T ss_pred hhhcCcchHHhccchhhhhhhhcccccccHHHHHHHhccChHhhccchhhhccccchHHHHHhhhhhHhhhhcccCCCCC
Confidence 6666555555554444 44444445555666666666666666666666666666
Q ss_pred chHHHHHHHHhccccceeeccc
Q 025158 232 IMMSQYLCIIFSLSVRISNLLD 253 (257)
Q Consensus 232 ~~~~~~~~~~~~~~L~~L~l~~ 253 (257)
+|..+.......++|+.|.+..
T Consensus 308 ~d~~l~aLg~~~~~L~~l~l~~ 329 (483)
T KOG4341|consen 308 TDEVLWALGQHCHNLQVLELSG 329 (483)
T ss_pred chHHHHHHhcCCCceEEEeccc
Confidence 6666666666666666666554
|
|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF12937 F-box-like: F-box-like; PDB: 1P22_A 2OVP_B 2OVR_B 2OVQ_B 1FS1_A 1FS2_C 1FQV_I 1LDK_E 2AST_B 2ASS_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >smart00256 FBOX A Receptor for Ubiquitination Targets | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >PF00646 F-box: F-box domain; InterPro: IPR001810 The F-box domain was first described as a sequence motif found in cyclin-F that interacts with the protein SKP1 [, ] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00367 LRR_CC Leucine-rich repeat - CC (cysteine-containing) subfamily | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0281 consensus Beta-TrCP (transducin repeats containing)/Slimb proteins [Function unknown] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2997 consensus F-box protein FBX9 [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >PLN03215 ascorbic acid mannose pathway regulator 1; Provisional | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG3763 consensus mRNA export factor TAP/MEX67 [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 257 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-27 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 1e-23 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 2e-06 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 3e-05 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 6e-22 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-17 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-16 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 1e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 5e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 8e-15 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 2e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-19 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-18 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-18 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-17 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 5e-15 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 1e-14 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 2e-14 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-13 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 8e-12 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 4e-09 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 2e-07 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 1e-05 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 7e-08 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 3e-07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-07 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 4e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 5e-05 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 1e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 4e-06 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 2e-05 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 3e-05 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 5e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 4e-04 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
Score = 106 bits (265), Expect = 3e-27
Identities = 51/241 (21%), Positives = 89/241 (36%), Gaps = 43/241 (17%)
Query: 25 VIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMN---NAGNRLVAALSIP 81
++ I S L +++ + V +R L S SLW +DL N + RL++ I
Sbjct: 17 LLGIFS-CLCLPELLKVSGVCKRWYR-LASDESLWQTLDLTGKNLHPDVTGRLLSQGVIA 74
Query: 82 RYRHVREINLEFAQDIEDRHLELLKT---------------------------------- 107
++ A+ ++ +
Sbjct: 75 FRCPRSFMDQPLAEHFSPFRVQHMDLSNSVIEVSTLHGILSQCSKLQNLSLEGLRLSDPI 134
Query: 108 -KCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHLV-KNC 165
L +L LNL+GC S+ ++ + S+C L ++ W T+ +Q V
Sbjct: 135 VNTLAKNSNLVRLNLSGCSGFSEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVS 194
Query: 166 KHIIDLNLSGC-KNLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKILIKCSSLRSLN 224
+ I LNLSG KNL L + L L+L+ V L + Q+ + + L+ L+
Sbjct: 195 ETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQE-FFQLNYLQHLS 253
Query: 225 L 225
L
Sbjct: 254 L 254
|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Length = 176 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 257 | |||
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.95 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.9 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.86 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.79 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.77 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.75 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.66 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 99.66 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.6 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.59 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.58 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.58 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.55 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.55 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.45 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.4 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.24 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 99.23 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.23 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.22 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 99.11 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.09 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.06 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.04 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.02 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.02 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.97 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.96 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.95 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.95 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.94 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 98.93 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.93 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.92 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.91 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.9 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.89 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.87 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.86 | |
| 1fs1_A | 53 | SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, L | 98.86 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.84 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.83 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.83 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.83 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.82 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.82 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.82 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.81 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.8 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.79 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.78 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.78 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.78 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.77 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.75 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.75 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.75 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.74 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.74 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.73 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.73 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.71 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.71 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.71 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.71 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.71 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 98.71 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.7 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 98.69 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.68 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.68 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.68 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.68 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.68 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.67 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.67 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 98.66 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.65 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.65 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.64 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.63 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.63 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.63 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.62 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.61 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.61 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.6 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.58 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.57 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.57 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.56 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.56 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.56 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.55 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.54 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.53 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 98.53 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.52 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.52 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.51 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.51 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.5 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.5 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.49 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.48 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.48 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.46 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.44 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.43 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.43 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.41 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.4 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.4 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.39 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.39 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.38 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.37 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 98.35 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 98.35 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.34 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.32 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.31 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 98.31 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.3 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.25 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.22 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 98.16 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 98.14 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 98.12 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 98.06 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.02 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 97.96 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.91 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 97.78 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 97.77 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 97.75 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.72 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.7 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 97.69 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.67 | |
| 3l2o_B | 312 | F-box only protein 4; small G protein fold, UBL co | 97.66 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 97.66 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 97.56 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 97.52 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.52 | |
| 2e31_A | 297 | FBS1, F-box only protein 2; ubiquitin, SCF, ubiqui | 97.48 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.44 | |
| 3v7d_B | 464 | Cell division control protein 4; WD 40 domain, pho | 97.36 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.3 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.29 | |
| 1p22_A | 435 | F-BOX/WD-repeat protein 1A; ubiquitination, degrad | 97.21 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 97.05 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 97.01 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 97.01 | |
| 2ovr_B | 445 | FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 | 96.99 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 96.87 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 96.71 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 96.53 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 95.81 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 94.14 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 92.58 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 90.46 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 90.4 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 81.99 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 80.08 |
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
Probab=99.95 E-value=1.9e-26 Score=190.90 Aligned_cols=229 Identities=19% Similarity=0.254 Sum_probs=168.9
Q ss_pred cccccccCcHHHHHHHHcCCChhhhHHHHhhcHHHHHHHhcCCCCceEeecccccchhhHHHHHh---------------
Q 025158 14 EETWSKETVPKVIRIMSTRLSQRDIISLLLVSPWLHRTLVSYPSLWLVIDLREMNNAGNRLVAAL--------------- 78 (257)
Q Consensus 14 ~~~~~~~~~pe~l~~If~~L~~~~l~~~~~v~~~w~~~~~~~~~~~~~l~l~~~~~~~~~~~~~~--------------- 78 (257)
+..|.+ +|+|++..||++|+..|+.+++.||++|++. ..++..|+.++++....... .+..+
T Consensus 6 ~~~~~~-LP~eil~~If~~L~~~d~~~~~~vc~~W~~~-~~~~~~~~~l~l~~~~~~~~-~~~~~~~~~l~~L~l~~n~l 82 (336)
T 2ast_B 6 GVSWDS-LPDELLLGIFSCLCLPELLKVSGVCKRWYRL-ASDESLWQTLDLTGKNLHPD-VTGRLLSQGVIAFRCPRSFM 82 (336)
T ss_dssp -CCSSS-SCHHHHHHHHTTSCHHHHHHTTSSCHHHHHH-HTCSTTSSEEECTTCBCCHH-HHHHHHHTTCSEEECTTCEE
T ss_pred cCChhh-CCHHHHHHHHHhCCHHHHHHHHHHHHHHHHH-hcCchhheeeccccccCCHH-HHHhhhhccceEEEcCCccc
Confidence 455643 4458999999999999999999999999987 56688899999987643322 11111
Q ss_pred -----cCccCCCccEEeccCCCCCchHHHHHHHHhccCCCCCccEEecCCCCCCChHHHHHHHhcCCCCcEEEecCCccc
Q 025158 79 -----SIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRV 153 (257)
Q Consensus 79 -----~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~~~~~L~~L~L~~~~~~~~~~l~~l~~~~~~L~~L~l~~~~~~ 153 (257)
....+++|+.|+++++. +++..+..+... +++|++|+++++ .+++.....+.. +++|++|++++|..+
T Consensus 83 ~~~~~~~~~~~~L~~L~L~~~~-l~~~~~~~~~~~----~~~L~~L~L~~~-~l~~~~~~~l~~-~~~L~~L~L~~~~~l 155 (336)
T 2ast_B 83 DQPLAEHFSPFRVQHMDLSNSV-IEVSTLHGILSQ----CSKLQNLSLEGL-RLSDPIVNTLAK-NSNLVRLNLSGCSGF 155 (336)
T ss_dssp CSCCCSCCCCBCCCEEECTTCE-ECHHHHHHHHTT----BCCCSEEECTTC-BCCHHHHHHHTT-CTTCSEEECTTCBSC
T ss_pred cccchhhccCCCCCEEEccCCC-cCHHHHHHHHhh----CCCCCEEeCcCc-ccCHHHHHHHhc-CCCCCEEECCCCCCC
Confidence 01234788888888854 665555555443 488888888887 677666666544 788888888887778
Q ss_pred CHHHHHHHHHcCCCCCEEeccCCCCCCHHHHHHHHhhCC-CCCEEeccCCC-CCCHHHHHHHHhcCCCCCeEecCCCCCC
Q 025158 154 TDIGIQHLVKNCKHIIDLNLSGCKNLLDKSLQLIADNYQ-ELESLNLTRCV-KLTDGGLQKILIKCSSLRSLNLYALSGY 231 (257)
Q Consensus 154 ~~~~~~~l~~~~~~L~~L~l~~~~~l~~~~l~~l~~~~~-~L~~L~l~~~~-~l~~~~l~~l~~~~~~L~~L~l~~c~~~ 231 (257)
++.++..+...+++|++|++++|..+++.++..+...++ +|++|++++|. .+++..+...+.++++|++|++++|..+
T Consensus 156 ~~~~l~~~~~~~~~L~~L~l~~~~~l~~~~~~~~~~~l~~~L~~L~l~~~~~~~~~~~l~~~~~~~~~L~~L~l~~~~~l 235 (336)
T 2ast_B 156 SEFALQTLLSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVML 235 (336)
T ss_dssp CHHHHHHHHHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTC
T ss_pred CHHHHHHHHhcCCCCCEEcCCCCCCcChHHHHHHHHhcccCCCEEEeCCCcccCCHHHHHHHHhhCCCCCEEeCCCCCcC
Confidence 887777777788888888888886788777777667788 88888888875 5787788887788888888888887766
Q ss_pred chHHHHHHHHhccccceeeccc
Q 025158 232 IMMSQYLCIIFSLSVRISNLLD 253 (257)
Q Consensus 232 ~~~~~~~~~~~~~~L~~L~l~~ 253 (257)
++.... .+...++|+.|++.+
T Consensus 236 ~~~~~~-~l~~l~~L~~L~l~~ 256 (336)
T 2ast_B 236 KNDCFQ-EFFQLNYLQHLSLSR 256 (336)
T ss_dssp CGGGGG-GGGGCTTCCEEECTT
T ss_pred CHHHHH-HHhCCCCCCEeeCCC
Confidence 665443 335567788887765
|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1fs1_A SKP2 F-BOX, cyclin A/CDK2-associated P19; F-BOX, LRR, leucine-rich repeat, SCF, ubiquitin, ubiquitin protein ligase; 1.80A {Homo sapiens} SCOP: a.158.1.1 PDB: 1ldk_E | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3l2o_B F-box only protein 4; small G protein fold, UBL conjugation pathway, ubiquitin Pro ligase, protein binding-cell cycle complex; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2e31_A FBS1, F-box only protein 2; ubiquitin, SCF, ubiquitin ligase, FBS1; 2.40A {Mus musculus} PDB: 2e32_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 257 | ||||
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 9e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 |
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: 28-residue LRR domain: Ribonuclease inhibitor species: Human (Homo sapiens) [TaxId: 9606]
Score = 41.1 bits (94), Expect = 9e-05
Identities = 16/95 (16%), Positives = 41/95 (43%), Gaps = 10/95 (10%)
Query: 115 DLESLNLNGCQKISDKGIEIISSTCPELKVFSIYWNVRVTDIGIQHL---VKNCKHIIDL 171
D++SL++ C+++SD + + +V + +T+ + + ++ + +L
Sbjct: 3 DIQSLDIQ-CEELSDARWAELLPLLQQCQVVRLDDC-GLTEARCKDISSALRVNPALAEL 60
Query: 172 NLSGCKNLLDKSLQLIAD----NYQELESLNLTRC 202
NL L D + + +++ L+L C
Sbjct: 61 NLRSN-ELGDVGVHCVLQGLQTPSCKIQKLSLQNC 94
|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 257 | |||
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.9 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.89 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.39 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.36 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.29 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.25 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.08 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.07 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 99.06 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 99.04 | |
| d1fs1a1 | 41 | Skp2 {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.85 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.74 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.73 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.67 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.64 | |
| d1nexb1 | 100 | Cdc4 F-box and linker domains {Baker's yeast (Sacc | 98.61 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.57 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.54 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.53 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.5 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.48 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.38 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.34 | |
| d2ovrb1 | 102 | F-box/WD repeat-containing protein 7, FBXW7 {Human | 98.29 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 98.27 | |
| d1p22a1 | 118 | F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom | 98.24 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.2 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.17 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.1 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 98.02 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.0 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.78 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.7 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 97.69 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 97.61 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 97.29 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.27 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.94 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 96.77 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 96.76 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 96.33 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 95.99 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 95.57 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 94.6 |
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: RNI-like family: Cyclin A/CDK2-associated p19, Skp2 domain: Cyclin A/CDK2-associated p19, Skp2 species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.90 E-value=1.3e-22 Score=162.27 Aligned_cols=189 Identities=21% Similarity=0.309 Sum_probs=137.0
Q ss_pred CCCceEeecccccchhhHHHHHhcCccCCCccEEeccCCCCCchHHHHHHHHhccCCCCCccEEecCCCCCCChHHHHHH
Q 025158 56 PSLWLVIDLREMNNAGNRLVAALSIPRYRHVREINLEFAQDIEDRHLELLKTKCLGSLQDLESLNLNGCQKISDKGIEII 135 (257)
Q Consensus 56 ~~~~~~l~l~~~~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~l~~l~~~~~~~~~~L~~L~L~~~~~~~~~~l~~l 135 (257)
...+++++++++..... .+..+ ..++++|++|+++++ .+++..+..++. +++|++|++++|..+++.++..+
T Consensus 45 ~~~L~~LdLs~~~i~~~-~l~~l-~~~c~~L~~L~L~~~-~l~~~~~~~l~~-----~~~L~~L~Ls~c~~itd~~l~~l 116 (284)
T d2astb2 45 PFRVQHMDLSNSVIEVS-TLHGI-LSQCSKLQNLSLEGL-RLSDPIVNTLAK-----NSNLVRLNLSGCSGFSEFALQTL 116 (284)
T ss_dssp CBCCCEEECTTCEECHH-HHHHH-HTTBCCCSEEECTTC-BCCHHHHHHHTT-----CTTCSEEECTTCBSCCHHHHHHH
T ss_pred CCCCCEEECCCCccCHH-HHHHH-HHhCCCccccccccc-CCCcHHHHHHhc-----CCCCcCccccccccccccccchh
Confidence 44567788877643333 33333 267788888888876 577777766543 57888888888878888888888
Q ss_pred HhcCCCCcEEEecCCcccCHHHHHH-HHHcCCCCCEEeccCC-CCCCHHHHHHHHhhCCCCCEEeccCCCCCCHHHHHHH
Q 025158 136 SSTCPELKVFSIYWNVRVTDIGIQH-LVKNCKHIIDLNLSGC-KNLLDKSLQLIADNYQELESLNLTRCVKLTDGGLQKI 213 (257)
Q Consensus 136 ~~~~~~L~~L~l~~~~~~~~~~~~~-l~~~~~~L~~L~l~~~-~~l~~~~l~~l~~~~~~L~~L~l~~~~~l~~~~l~~l 213 (257)
...||+|++|++++|..++++++.. ++..+++|++|++++| ..+++.++..+...||+|++|++++|..+++.++..+
T Consensus 117 ~~~~~~L~~L~ls~c~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~~~~l~~l~~~~~~L~~L~L~~~~~itd~~~~~l 196 (284)
T d2astb2 117 LSSCSRLDELNLSWCFDFTEKHVQVAVAHVSETITQLNLSGYRKNLQKSDLSTLVRRCPNLVHLDLSDSVMLKNDCFQEF 196 (284)
T ss_dssp HHHCTTCCEEECCCCTTCCHHHHHHHHHHSCTTCCEEECCSCGGGSCHHHHHHHHHHCTTCSEEECTTCTTCCGGGGGGG
T ss_pred hHHHHhccccccccccccccccchhhhcccccccchhhhcccccccccccccccccccccccccccccccCCCchhhhhh
Confidence 7788888888888887788777755 3344578888888876 3577888888877788888888888877888777764
Q ss_pred HhcCCCCCeEecCCCCCCchHHHHHHHHhccccceeecccc
Q 025158 214 LIKCSSLRSLNLYALSGYIMMSQYLCIIFSLSVRISNLLDW 254 (257)
Q Consensus 214 ~~~~~~L~~L~l~~c~~~~~~~~~~~~~~~~~L~~L~l~~~ 254 (257)
..|++|++|++++|..+++.++.. ....++|+.|++.+.
T Consensus 197 -~~~~~L~~L~L~~C~~i~~~~l~~-L~~~~~L~~L~l~~~ 235 (284)
T d2astb2 197 -FQLNYLQHLSLSRCYDIIPETLLE-LGEIPTLKTLQVFGI 235 (284)
T ss_dssp -GGCTTCCEEECTTCTTCCGGGGGG-GGGCTTCCEEECTTS
T ss_pred -cccCcCCEEECCCCCCCChHHHHH-HhcCCCCCEEeeeCC
Confidence 467888888888888888776543 345677888877653
|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1fs1a1 a.158.1.1 (A:109-149) Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1nexb1 a.158.1.1 (B:270-369) Cdc4 F-box and linker domains {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ovrb1 a.158.1.1 (B:2263-2364) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1p22a1 a.158.1.1 (A:135-252) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|