Citrus Sinensis ID: 025162


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------
MDSSANRSFLRAFDYDGSSSLTFGERICAACIPLIAIIEAVVITVASCFRYRPPVQKCRFDVGDLARLAAESRFSVNELEALSELYKNLSCSIIKDGLIHKEELQVALFQAPYGENLFLDRVFDLFDEKKNGVIDFEEFVHALNVFHPYAPIEDKIDFAFRLYDLRQTGYIEREEVKQMVAAILMESEIKLPDDLLEAIIDKTFADADIDKDGRINKEEWKEFAVRNPSLLKNMTLPYLTDITTIFPSFVFNTEVED
cccccccccEEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHccccccccHHHHHHHHccccccccCCHHHHHHHHcHccccccHHHHHHHEEEcEEccccccEEHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccHHHHHcccccccccccccccccccccccc
********FLRAFDYDGSSSLTFGERICAACIPLIAIIEAVVITVASCFRYRPPVQKCRFDVGDLARLAAESRFSVNELEALSELYKNLSCSIIKDGLIHKEELQVALFQAPYGENLFLDRVFDLFDEKKNGVIDFEEFVHALNVFHPYAPIEDKIDFAFRLYDLRQTGYIEREEVKQMVAAILMESEIKLPDDLLEAIIDKTFADADIDKDGRINKEEWKEFAVRNPSLLKNMTLPYLTDITTIFPSFVFNT****
xxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDSSANRSFLRAFDYDGSSSLTFGERICAACIPLIAIIEAVVITVASCFRYRPPVQKCRFDVGDLARLAAESRFSVNELEALSELYKNLSCSIIKDGLIHKEELQVALFQAPYGENLFLDRVFDLFDEKKNGVIDFEEFVHALNVFHPYAPIEDKIDFAFRLYDLRQTGYIEREEVKQMVAAILMESEIKLPDDLLEAIIDKTFADADIDKDGRINKEEWKEFAVRNPSLLKNMTLPYLTDITTIFPSFVFNTEVED

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Calcineurin B-like protein 10 Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.confidentQ7FRS8
Calcineurin B-like protein 10 Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ3HRN7
Calcineurin B-like protein 9 Acts as a calcium sensor. CBL proteins interact with CIPK serine-threonine protein kinases. Binding of a CBL protein to the regulatory NAF domain of a CIPK protein lead to the activation of the kinase in a calcium-dependent manner.probableQ3HRN8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZFD, chain A
Confidence level:very confident
Coverage over the Query: 64-246
View the alignment between query and template
View the model in PyMOL
Template: 2BE4, chain A
Confidence level:very confident
Coverage over the Query: 3-229
View the alignment between query and template
View the model in PyMOL