Query         025175
Match_columns 256
No_of_seqs    214 out of 649
Neff          3.8 
Searched_HMMs 46136
Date          Fri Mar 29 03:21:14 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025175.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025175hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 smart00774 WRKY DNA binding do 100.0   2E-32 4.3E-37  200.8   5.1   59   91-149     1-59  (59)
  2 PF03106 WRKY:  WRKY DNA -bindi 100.0 8.1E-33 1.7E-37  202.6   2.7   59   91-150     1-59  (60)
  3 PF04500 FLYWCH:  FLYWCH zinc f  93.7   0.047   1E-06   37.6   2.1   52   88-149     9-62  (62)
  4 PF03101 FAR1:  FAR1 DNA-bindin  93.0   0.098 2.1E-06   39.2   2.9   30  121-151    60-89  (91)
  5 PF03859 CG-1:  CG-1 domain;  I  37.8      12 0.00027   31.5   0.3    9   91-99     51-59  (118)
  6 PF11159 DUF2939:  Protein of u  29.5      63  0.0014   24.9   3.0   40  208-247    34-79  (95)
  7 KOG0673 Thymidylate synthase [  26.2      28  0.0006   33.1   0.6   31   89-119   111-162 (293)
  8 PLN03097 FHY3 Protein FAR-RED   25.5      68  0.0015   34.8   3.4   32  121-153   159-190 (846)
  9 PF06534 RGM_C:  Repulsive guid  19.2      78  0.0017   28.4   2.0   29  227-255   150-178 (179)
 10 PF10929 DUF2811:  Protein of u  18.6 1.2E+02  0.0027   22.6   2.6   36  214-249     5-42  (57)

No 1  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=99.97  E-value=2e-32  Score=200.80  Aligned_cols=59  Identities=59%  Similarity=1.258  Sum_probs=57.1

Q ss_pred             ccCCccccccCccccCCCCCCCcccccCCCCCCccccceeecCCCCCEEEEEeeccCCC
Q 025175           91 VKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNH  149 (256)
Q Consensus        91 ~~DGy~WRKYGQK~ikgn~~pRsYYRCs~~~~C~akKqVQrs~~D~~i~~vtY~GeHnH  149 (256)
                      ++|||+|||||||.|+|+++||+||||++.++|+|+|+|||+++|+.+++|||+|+|||
T Consensus         1 ~~DGy~WRKYGQK~ikgs~~pRsYYrCt~~~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774        1 LDDGYQWRKYGQKVIKGSPFPRSYYRCTYSQGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCcccccccCcEecCCCcCcceEEeccccCCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            47999999999999999999999999999789999999999999999999999999998


No 2  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=99.97  E-value=8.1e-33  Score=202.61  Aligned_cols=59  Identities=61%  Similarity=1.294  Sum_probs=52.2

Q ss_pred             ccCCccccccCccccCCCCCCCcccccCCCCCCccccceeecCCCCCEEEEEeeccCCCC
Q 025175           91 VKDGYQWRKYGQKVTRDNPSPRAYFKCSFAPSCPVKKKVQRSAEDPSILVATYEGEHNHP  150 (256)
Q Consensus        91 ~~DGy~WRKYGQK~ikgn~~pRsYYRCs~~~~C~akKqVQrs~~D~~i~~vtY~GeHnH~  150 (256)
                      ++|||+|||||||.|+|+++||+||||++. +|+|+|+|||+.+|+.+++|||+|+|||+
T Consensus         1 ~~Dgy~WRKYGqK~i~g~~~pRsYYrCt~~-~C~akK~Vqr~~~d~~~~~vtY~G~H~h~   59 (60)
T PF03106_consen    1 LDDGYRWRKYGQKNIKGSPYPRSYYRCTHP-GCPAKKQVQRSADDPNIVIVTYEGEHNHP   59 (60)
T ss_dssp             --SSS-EEEEEEEEETTTTCEEEEEEEECT-TEEEEEEEEEETTCCCEEEEEEES--SS-
T ss_pred             CCCCCchhhccCcccCCCceeeEeeecccc-ChhheeeEEEecCCCCEEEEEEeeeeCCC
Confidence            589999999999999999999999999995 99999999999999999999999999997


No 3  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=93.73  E-value=0.047  Score=37.65  Aligned_cols=52  Identities=31%  Similarity=0.564  Sum_probs=27.8

Q ss_pred             cccccCCccccccCccccCCCCCCCcccccCCC--CCCccccceeecCCCCCEEEEEeeccCCC
Q 025175           88 TLIVKDGYQWRKYGQKVTRDNPSPRAYFKCSFA--PSCPVKKKVQRSAEDPSILVATYEGEHNH  149 (256)
Q Consensus        88 s~~~~DGy~WRKYGQK~ikgn~~pRsYYRCs~~--~~C~akKqVQrs~~D~~i~~vtY~GeHnH  149 (256)
                      ..++-|||.-.++...      ....|+||+..  .+|+|+=.+.  .++.  .++...++|||
T Consensus         9 ~~L~~~Gy~y~~~~~~------~~~~~WrC~~~~~~~C~a~~~~~--~~~~--~~~~~~~~HnH   62 (62)
T PF04500_consen    9 PKLVYDGYRYYFNKRN------DGKTYWRCSRRRSHGCRARLITD--AGDG--RVVRTNGEHNH   62 (62)
T ss_dssp             EEEEETTEEEEEEEE-------SS-EEEEEGGGTTS----EEEEE----TT--EEEE-S---SS
T ss_pred             EEEEECCeEEECcCCC------CCcEEEEeCCCCCCCCeEEEEEE--CCCC--EEEECCCccCC
Confidence            4567899987776555      34689999974  3799998887  3343  33344499998


No 4  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=92.96  E-value=0.098  Score=39.24  Aligned_cols=30  Identities=33%  Similarity=0.565  Sum_probs=26.3

Q ss_pred             CCCccccceeecCCCCCEEEEEeeccCCCCC
Q 025175          121 PSCPVKKKVQRSAEDPSILVATYEGEHNHPQ  151 (256)
Q Consensus       121 ~~C~akKqVQrs~~D~~i~~vtY~GeHnH~~  151 (256)
                      .+|+|+=.|-+.. |....++.+..+|||+.
T Consensus        60 tgC~a~i~v~~~~-~~~w~v~~~~~~HNH~L   89 (91)
T PF03101_consen   60 TGCKARINVKRRK-DGKWRVTSFVLEHNHPL   89 (91)
T ss_pred             cCCCEEEEEEEcc-CCEEEEEECcCCcCCCC
Confidence            5999999998876 66788899999999987


No 5  
>PF03859 CG-1:  CG-1 domain;  InterPro: IPR005559  CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein []. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin-binding domain and ankyrins [].; GO: 0005516 calmodulin binding, 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus
Probab=37.85  E-value=12  Score=31.48  Aligned_cols=9  Identities=67%  Similarity=1.224  Sum_probs=7.6

Q ss_pred             ccCCccccc
Q 025175           91 VKDGYQWRK   99 (256)
Q Consensus        91 ~~DGy~WRK   99 (256)
                      -.|||.|||
T Consensus        51 RkDG~~WrK   59 (118)
T PF03859_consen   51 RKDGHNWRK   59 (118)
T ss_pred             hcccceeEE
Confidence            469999995


No 6  
>PF11159 DUF2939:  Protein of unknown function (DUF2939);  InterPro: IPR021330  This bacterial family of proteins has no known function. 
Probab=29.49  E-value=63  Score=24.93  Aligned_cols=40  Identities=25%  Similarity=0.374  Sum_probs=28.5

Q ss_pred             cccCChHHHHHHHHHHHHhhhC------CCChHHHHHHHHhccccc
Q 025175          208 QQIEAPAIHQILVQQMASNLTK------DPNFTAALAAAISGRFAD  247 (256)
Q Consensus       208 ~~~~~p~~~~~lveqma~slt~------DPnFtaALaaAis~~i~~  247 (256)
                      ..++.|.+|..|.+|+...+.+      +++.-++|..++.+.+.+
T Consensus        34 ~~VD~~avr~slk~ql~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~   79 (95)
T PF11159_consen   34 RYVDFPAVRASLKDQLNAELVSRIGPEVADDPLAALGAMLAPGLVD   79 (95)
T ss_pred             HHcCHHHHHHHHHHHHHHHHHhhcCccccCCHHHHHHHHHHHHHHH
Confidence            3467789999999998887654      356666777777755544


No 7  
>KOG0673 consensus Thymidylate synthase [Nucleotide transport and metabolism]
Probab=26.22  E-value=28  Score=33.12  Aligned_cols=31  Identities=29%  Similarity=0.677  Sum_probs=21.7

Q ss_pred             ccccCCccccccCcc---------------------ccCCCCCCCcccccCC
Q 025175           89 LIVKDGYQWRKYGQK---------------------VTRDNPSPRAYFKCSF  119 (256)
Q Consensus        89 ~~~~DGy~WRKYGQK---------------------~ikgn~~pRsYYRCs~  119 (256)
                      +-+-=|++||-+|-|                     .||+||+-|----|.+
T Consensus       111 lgpvyGfqWrHfgA~Y~~~~~dy~gqgvdQL~~vI~~ik~NP~drRIimsAw  162 (293)
T KOG0673|consen  111 LGPVYGFQWRHFGARYEDCDSDYTGQGVDQLADVINKIKNNPDDRRIIMSAW  162 (293)
T ss_pred             cccccceeeeecCccccccccccccccHHHHHHHHHHHhcCCccceeeeecc
Confidence            344568999999977                     4678887776544443


No 8  
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=25.50  E-value=68  Score=34.84  Aligned_cols=32  Identities=22%  Similarity=0.447  Sum_probs=26.7

Q ss_pred             CCCccccceeecCCCCCEEEEEeeccCCCCCCC
Q 025175          121 PSCPVKKKVQRSAEDPSILVATYEGEHNHPQPT  153 (256)
Q Consensus       121 ~~C~akKqVQrs~~D~~i~~vtY~GeHnH~~p~  153 (256)
                      .||+|.=.|.+..+ ..-.++-+..+|||+.-+
T Consensus       159 tGC~A~m~Vk~~~~-gkW~V~~fv~eHNH~L~p  190 (846)
T PLN03097        159 TDCKASMHVKRRPD-GKWVIHSFVKEHNHELLP  190 (846)
T ss_pred             CCCceEEEEEEcCC-CeEEEEEEecCCCCCCCC
Confidence            59999999988544 458899999999999943


No 9  
>PF06534 RGM_C:  Repulsive guidance molecule (RGM) C-terminus;  InterPro: IPR009496 This entry contains of several mammalian and one bird sequence from Gallus gallus (Chicken) and represents the C-terminal region of several sequences, but in others it represents the full protein. All of the mammalian proteins are hypothetical and have no known function, but Q8JG54 from SWISSPROT from the chicken is annotated as being a repulsive guidance molecule (RGM). RGM is a GPI-linked axon guidance molecule of the retinotectal system. RGM is repulsive for a subset of axons, those from the temporal half of the retina. Temporal retinal axons invade the anterior optic tectum in a superficial layer, and encounter RGM expressed in a gradient with increasing concentration along the anterior-posterior axis. Temporal axons are able to receive posterior-dependent information by sensing gradients or concentrations of guidance cues. Thus, RGM is likely to provide positional information for temporal axons invading the optic tectum in the stratum opticum [].
Probab=19.21  E-value=78  Score=28.41  Aligned_cols=29  Identities=38%  Similarity=0.475  Sum_probs=22.1

Q ss_pred             hhCCCChHHHHHHHHhcccccccccccCC
Q 025175          227 LTKDPNFTAALAAAISGRFADQARTQRWS  255 (256)
Q Consensus       227 lt~DPnFtaALaaAis~~i~~~~~~~~~~  255 (256)
                      .|-|+||++|-.+|+...-.-+....||-
T Consensus       150 TTGD~nft~aA~~AleD~~~l~p~~~~~h  178 (179)
T PF06534_consen  150 TTGDANFTAAAYSALEDVKALHPDPERWH  178 (179)
T ss_pred             ecCCccHHHHHHHHHHHHHHhcCchhccc
Confidence            48999999999999877655555555653


No 10 
>PF10929 DUF2811:  Protein of unknown function (DUF2811);  InterPro: IPR021231  This is a bacterial family of uncharacterised proteins. 
Probab=18.56  E-value=1.2e+02  Score=22.64  Aligned_cols=36  Identities=25%  Similarity=0.370  Sum_probs=29.1

Q ss_pred             HHHHHHHHHHHHhhhCCCChH--HHHHHHHhccccccc
Q 025175          214 AIHQILVQQMASNLTKDPNFT--AALAAAISGRFADQA  249 (256)
Q Consensus       214 ~~~~~lveqma~slt~DPnFt--aALaaAis~~i~~~~  249 (256)
                      +++..|.+.|..=|-..|++-  --+.|||+|.+++..
T Consensus         5 eiPe~L~~~m~~fie~hP~WDQ~Rl~~aALa~FL~QnG   42 (57)
T PF10929_consen    5 EIPEDLHQAMKDFIETHPNWDQYRLFQAALAGFLLQNG   42 (57)
T ss_pred             cccHHHHHHHHHHHHcCCCchHHHHHHHHHHHHHHHcC
Confidence            567889999999999999974  457788888887654


Done!