Citrus Sinensis ID: 025200

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MDVVIEVRDARIPLSTTHPLMDQWLGNRKRILVLNREDMISMADRNAWATYFAKQGTKVIFSNGQLGMGTMKLSRLAKALASDVNVKRRSKGLLPRAVRAGIVGYPNVGKSSLINRLLKRRMCPAAPRPGVTRVLKWVRFGKDLEFLDSPGIIPMRISDQAAAIKLAICDDIGERSYDVADVAAILVQMLARIPTVGITALQNRYKIDMDGTCGKTFVQKLALHLFNGDTHQAAFRILTDFRKGKFGWISLERPPR
ccEEEEEEEccccccccccHHHHHHccccEEEEEEccccccHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccccHHHHHHHHccccccccccccccccccEEEEEcccEEECccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccHHHHHHccccccccccHHHHHHHHHHHHccccHHHHHHHHHHHHHcccccccccccccc
MDVVIEVRDARIPLSTTHPLMDQWLGNRKRILVLNREDMISMADRNAWATYFAKQGTKVIFSNGQLGMGTMKLSRLAKALASDVNVKRRSKGLLPRAVRAGIVGYPNVGKSSLINRLLKRRMCPAAPRPGVTRVLKWVRFGKDLEFLDSPGIIPMRISDQAAAIKLAICDDIGERSYDVADVAAILVQMLARIPTVGITALQNRYKIDMDGTCGKTFVQKLALHLFNGDTHQAAFRILTDFRKGKFGWISLERPP*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVVIEVRDARIPLSTTHPLMDQWLGNRKRILVLNREDMISMADRNAWATYFAKQGTKVIFSNGQLGMGTMKLSRLAKALASDVNVKRRSKGLLPRAVRAGIVGYPNVGKSSLINRLLKRRMCPAAPRPGVTRVLKWVRFGKDLEFLDSPGIIPMRISDQAAAIKLAICDDIGERSYDVADVAAILVQMLARIPTVGITALQNRYKIDMDGTCGKTFVQKLALHLFNGDTHQAAFRILTDFRKGKFGWISLERPPR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ribosome biogenesis GTPase A Essential protein that is required for a late step of 50S ribosomal subunit assembly. Has GTPase activity that is stimulated by interaction with the immature 50S ribosome subunit. Binds to the 23S rRNA. Required for the association of ribosomal proteins rplP and rpmA with the large subunit.probableQ65JP4
Ribosome biogenesis GTPase A Essential protein that is required for a late step of 50S ribosomal subunit assembly. Has GTPase activity that is stimulated by interaction with the immature 50S ribosome subunit. Binds to the 23S rRNA. Required for the association of ribosomal proteins rplP and rpmA with the large subunit.probableE0TTS5
Ribosome biogenesis GTPase A Required for a late step of 50S ribosomal subunit assembly. Has GTPase activity. Binds to the 23S rRNA.probableB7GGD6

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1PUJ, chain A
Confidence level:very confident
Coverage over the Query: 1-123,136-255
View the alignment between query and template
View the model in PyMOL