Query         025218
Match_columns 256
No_of_seqs    154 out of 405
Neff          5.3 
Searched_HMMs 46136
Date          Fri Mar 29 03:43:31 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025218.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025218hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1627 Translation elongation 100.0 3.2E-76 6.9E-81  491.8   9.2  156   98-256     1-160 (160)
  2 PF00647 EF1G:  Elongation fact 100.0   9E-65   2E-69  405.4   4.7  107   95-203     1-107 (107)
  3 cd03181 GST_C_EFB1gamma GST_C   96.7   0.001 2.2E-08   52.0   2.6   46    3-48     76-121 (123)
  4 cd03204 GST_C_GDAP1 GST_C fami  91.4    0.11 2.3E-06   42.0   1.5   34    4-37     76-111 (111)
  5 cd03187 GST_C_Phi GST_C family  91.3    0.15 3.3E-06   39.1   2.3   27   15-41     92-118 (118)
  6 PF00043 GST_C:  Glutathione S-  90.4    0.15 3.4E-06   37.7   1.6   31    4-35     65-95  (95)
  7 cd03178 GST_C_Ure2p_like GST_C  90.4    0.16 3.6E-06   38.8   1.7   28   14-41     85-112 (113)
  8 cd03207 GST_C_8 GST_C family,   90.2    0.15 3.3E-06   38.6   1.3   26   17-42     76-101 (103)
  9 cd03188 GST_C_Beta GST_C famil  89.6    0.18 3.9E-06   38.4   1.4   24   18-41     91-114 (114)
 10 cd03185 GST_C_Tau GST_C family  88.9    0.27 5.8E-06   38.4   2.0   27   18-44     90-116 (126)
 11 cd03203 GST_C_Lambda GST_C fam  87.9    0.35 7.5E-06   38.4   2.0   30   14-43     82-111 (120)
 12 cd03183 GST_C_Theta GST_C fami  87.5    0.34 7.4E-06   38.0   1.7   30   13-42     90-121 (126)
 13 cd03196 GST_C_5 GST_C family,   87.1    0.33 7.2E-06   38.3   1.5   23   18-40     92-114 (115)
 14 cd03210 GST_C_Pi GST_C family,  86.4    0.56 1.2E-05   37.3   2.4   34   15-48     84-117 (126)
 15 cd03191 GST_C_Zeta GST_C famil  86.1    0.48   1E-05   36.9   1.9   25   18-42     94-118 (121)
 16 cd03209 GST_C_Mu GST_C family,  85.4    0.57 1.2E-05   36.9   2.0   31   16-46     82-112 (121)
 17 cd03190 GST_C_ECM4_like GST_C   80.7     1.1 2.4E-05   36.6   2.0   26   18-43     93-118 (142)
 18 cd03177 GST_C_Delta_Epsilon GS  79.4     1.3 2.8E-05   34.4   1.9   24   18-41     87-110 (118)
 19 cd03198 GST_C_CLIC GST_C famil  79.1     1.1 2.3E-05   37.4   1.4   25   18-42     99-123 (134)
 20 cd03184 GST_C_Omega GST_C fami  76.7     1.6 3.4E-05   34.5   1.7   28   17-44     87-114 (124)
 21 cd03206 GST_C_7 GST_C family,   73.9     2.1 4.6E-05   32.3   1.7   21   17-37     80-100 (100)
 22 cd03201 GST_C_DHAR GST_C famil  73.8       3 6.5E-05   33.4   2.7   24   19-42     86-109 (121)
 23 cd03208 GST_C_Alpha GST_C fami  69.4     3.1 6.7E-05   34.0   1.8   30   14-43     86-115 (137)
 24 cd03180 GST_C_2 GST_C family,   67.4     3.5 7.5E-05   30.9   1.6   21   17-37     90-110 (110)
 25 cd03186 GST_C_SspA GST_N famil  65.6     3.6 7.8E-05   31.2   1.4   22   19-40     85-106 (107)
 26 KOG0867 Glutathione S-transfer  65.4     4.6 9.9E-05   35.9   2.2   27   14-40    180-206 (226)
 27 PF13410 GST_C_2:  Glutathione   64.1     2.5 5.3E-05   29.6   0.2   17   14-30     53-69  (69)
 28 PLN02907 glutamate-tRNA ligase  63.2     2.8   6E-05   44.0   0.5   27   17-43    140-168 (722)
 29 PF09868 DUF2095:  Uncharacteri  56.1     5.9 0.00013   32.9   1.1   28   95-122     2-29  (128)
 30 cd03200 GST_C_JTV1 GST_C famil  53.1     8.1 0.00018   29.6   1.5   17   18-34     80-96  (96)
 31 cd03194 GST_C_3 GST_C family,   48.0     9.1  0.0002   30.0   1.0   20   22-41     93-112 (114)
 32 cd03195 GST_C_4 GST_C family,   44.4      11 0.00025   29.4   1.1   20   22-41     92-111 (114)
 33 KOG4420 Uncharacterized conser  44.1      12 0.00027   35.2   1.4   43    2-44    244-288 (325)
 34 KOG0867 Glutathione S-transfer  42.2     4.4 9.5E-05   36.0  -1.8   47    5-52    126-174 (226)
 35 PF13200 DUF4015:  Putative gly  39.6      23  0.0005   33.7   2.5   71  139-215   136-220 (316)
 36 PF14497 GST_C_3:  Glutathione   33.5      23  0.0005   26.6   1.2   16   17-32     83-98  (99)
 37 cd03193 GST_C_Metaxin GST_C fa  28.4      34 0.00073   25.0   1.3   14   18-31     74-87  (88)
 38 PF11280 DUF3081:  Protein of u  25.7      95  0.0021   23.9   3.4   35  136-174    34-78  (79)
 39 KOG1668 Elongation factor 1 be  25.6      35 0.00076   31.3   1.2   30   10-39     40-69  (231)
 40 KOG0406 Glutathione S-transfer  23.1      58  0.0012   29.8   2.1   26   19-44    187-212 (231)

No 1  
>KOG1627 consensus Translation elongation factor EF-1 gamma [Translation, ribosomal structure and biogenesis]
Probab=100.00  E-value=3.2e-76  Score=491.79  Aligned_cols=156  Identities=51%  Similarity=0.930  Sum_probs=150.9

Q ss_pred             CCCCCCCCCCcchhhhhhhhccCCCccchhhhhhhhhccCCCCceEEEEeeecCCCcceeEEeccchhhHhhhhHHhhhh
Q 025218           98 NPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLARKY  177 (256)
Q Consensus        98 ~Pl~~Lp~s~f~ld~wKr~YSN~dt~~~~~alp~Fwe~fd~egySlW~~~Yky~~El~~~Fms~Nli~Gf~QRle~~rK~  177 (256)
                      |||++||+|+|+||+|||+|||+||  +.+||||||||||+||||||+|+||||+||+++||||||||||||||+++|||
T Consensus         1 ~pl~~lp~~~Fvldd~kr~ySn~dt--~~~a~P~f~e~~d~e~ys~w~~~Yky~eeL~~~fms~nli~g~~qrl~~~rk~   78 (160)
T KOG1627|consen    1 DPLDLLPKSTFVLDDWKRKYSNEDT--REVALPWFWEHFDPEGYSLWKVDYKYNEELTLTFMSCNLIGGFFQRLDKSRKY   78 (160)
T ss_pred             CchhhCCCCccchhhhhhhhccccc--ccccchHHHHHhCcccceeeeccccCchHHHHHHHHhhhhhHHHHHHHHHHHh
Confidence            7999999999999999999999999  78999999999999999999999999999999999999999999999999999


Q ss_pred             cceeEEEEeeCCCcceEEEEEEeCCCCCcccc--ccccCccceeeEEcCCCCHHHHHHHHHHHccCCCC--CCeeecccc
Q 025218          178 AFGKMLIIGNEPPYKVKGLWLFRGPEIPKFVM--DECYDMELYDWKKADISDEEQKERVNQMIEDHEPF--EGEALLDAK  253 (256)
Q Consensus       178 aFg~~~v~Ge~~~~~I~Gvw~~RGq~~p~~~~--~~~~d~esy~~~KLD~~~~edk~~v~~y~~w~~~~--~g~~~~~gk  253 (256)
                      +||||+|+|+|++++|+|+|+||||++ +|.|  |++||||||+||||||+++|+|++|++||+|++++  .||.++|||
T Consensus        79 ~f~~~~~~g~~~~~~i~g~~~~rg~el-a~~~spDwq~D~EsY~~tKLD~~see~k~~V~ey~sWeg~f~~~Gkaf~qgK  157 (160)
T KOG1627|consen   79 AFGSMVLFGENGNSTISGAWVFRGQEL-APAFSPDWQPDYESYTWTKLDPGSEETKELVNEYFSWEGPFEGNGKAFNDGK  157 (160)
T ss_pred             hheeEEEeccCCCCcceEEEEEecccc-ccccCccccccccceeeeecCCCCHHHHHHHHHHHhhcccccccchhhhccc
Confidence            999999999999999999999999997 3466  89999999999999999999999999999999975  569999999


Q ss_pred             ccC
Q 025218          254 CFK  256 (256)
Q Consensus       254 vfK  256 (256)
                      |||
T Consensus       158 i~K  160 (160)
T KOG1627|consen  158 IFK  160 (160)
T ss_pred             ccC
Confidence            998


No 2  
>PF00647 EF1G:  Elongation factor 1 gamma, conserved domain;  InterPro: IPR001662 Translation elongation factors are responsible for two main processes during protein synthesis on the ribosome [, , ]. EF1A (or EF-Tu) is responsible for the selection and binding of the cognate aminoacyl-tRNA to the A-site (acceptor site) of the ribosome. EF2 (or EF-G) is responsible for the translocation of the peptidyl-tRNA from the A-site to the P-site (peptidyl-tRNA site) of the ribosome, thereby freeing the A-site for the next aminoacyl-tRNA to bind. Elongation factors are responsible for achieving accuracy of translation and both EF1A and EF2 are remarkably conserved throughout evolution. Elongation factor EF1B (also known as EF-Ts or EF-1beta/gamma/delta) is a nucleotide exchange factor that is required to regenerate EF1A from its inactive form (EF1A-GDP) to its active form (EF1A-GTP). EF1A is then ready to interact with a new aminoacyl-tRNA to begin the cycle again. EF1B is more complex in eukaryotes than in bacteria, and can consist of three subunits: EF1B-alpha (or EF-1beta), EF1B-gamma (or EF-1gamma) and EF1B-beta (or EF-1delta) []. This entry represents a conserved domain usually found near the C terminus of EF1B-gamma chains, a peptide of 410-440 residues. The gamma chain appears to play a role in anchoring the EF1B complex to the beta and delta chains and to other cellular components.  More information about these proteins can be found at Protein of the Month: Elongation Factors [].; GO: 0003746 translation elongation factor activity, 0006414 translational elongation, 0005853 eukaryotic translation elongation factor 1 complex; PDB: 1PBU_A.
Probab=100.00  E-value=9e-65  Score=405.37  Aligned_cols=107  Identities=59%  Similarity=1.183  Sum_probs=83.4

Q ss_pred             CCCCCCCCCCCCCcchhhhhhhhccCCCccchhhhhhhhhccCCCCceEEEEeeecCCCcceeEEeccchhhHhhhhHHh
Q 025218           95 KPKNPLDLLPPSKMILDDWKRLYSNTKSNFREVAIKGFWDMYDPEGYSLWFCDYKYNDENTVSFVTLNKVSGFLQRMDLA  174 (256)
Q Consensus        95 K~k~Pl~~Lp~s~f~ld~wKr~YSN~dt~~~~~alp~Fwe~fd~egySlW~~~Yky~~El~~~Fms~Nli~Gf~QRle~~  174 (256)
                      |+|||||+||||+|+||+|||.|||+||  +++||||||||||+||||||+|+|+||+|||++|||||||||||||||++
T Consensus         1 K~k~Pl~~lp~s~f~lD~wKr~YSN~d~--~~~a~p~Fwe~~d~eg~Slw~~~Yky~~El~~~fmt~Nli~Gf~QRle~~   78 (107)
T PF00647_consen    1 KPKNPLDLLPKSTFVLDEWKRKYSNEDT--RTVAMPWFWENFDPEGYSLWFCDYKYNDELTMTFMTCNLIGGFFQRLEKL   78 (107)
T ss_dssp             ----GGGSS----S-HHHHHHHHHHS-G--GGTHHHHHHSS--TTT-EEEEE--S-GGG---STTHHHHHHHHHHHGGGT
T ss_pred             CCCChHHHCCCCCCCHHHhhhhhcCCCc--hhhHHHHHHHhCCccccEEEEEecCChhhhccceeehhHHHHHHHHHHHH
Confidence            6899999999999999999999999999  89999999999999999999999999999999999999999999999999


Q ss_pred             hhhcceeEEEEeeCCCcceEEEEEEeCCC
Q 025218          175 RKYAFGKMLIIGNEPPYKVKGLWLFRGPE  203 (256)
Q Consensus       175 rK~aFg~~~v~Ge~~~~~I~Gvw~~RGq~  203 (256)
                      ||||||+|+|||++++++|+|||||||||
T Consensus        79 rK~aFg~~~v~G~~~~~~I~Gvwv~rG~e  107 (107)
T PF00647_consen   79 RKYAFGSMSVFGEDNNSDISGVWVFRGQE  107 (107)
T ss_dssp             GGGEEE--EEES-STT-EEEEEEEESSSS
T ss_pred             hhhheeEEEEEecCCCCceEEEEEEecCC
Confidence            99999999999999999999999999997


No 3  
>cd03181 GST_C_EFB1gamma GST_C family, Gamma subunit of Elongation Factor 1B (EFB1gamma) subfamily; EF1Bgamma is part of the eukaryotic translation elongation factor-1 (EF1) complex which plays a central role in the elongation cycle during protein biosynthesis. EF1 consists of two functionally distinct units, EF1A and EF1B. EF1A catalyzes the GTP-dependent binding of aminoacyl-tRNA to the ribosomal A site concomitant with the hydrolysis of GTP. The resulting inactive EF1A:GDP complex is recycled to the active GTP form by the guanine-nucleotide exchange factor EF1B, a complex composed of at least two subunits, alpha and gamma. Metazoan EFB1 contain a third subunit, beta. The EF1B gamma subunit contains a GST fold consisting of an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. The GST-like domain of EF1Bgamma is believed to mediate the dimerization of the EF1 complex, which in yeast is a dimer of the heterotrimer EF1A:EF1Balpha:EF1Bgamma. In addition to its role
Probab=96.75  E-value=0.001  Score=52.02  Aligned_cols=46  Identities=37%  Similarity=0.707  Sum_probs=39.6

Q ss_pred             cchhhHHHHhCChhhhhcCCchHHHHHHHhhCcchhhhcCCccccc
Q 025218            3 CNLYYGFKLIMTKSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAE   48 (256)
Q Consensus         3 ~~L~~~f~~vld~e~Rk~~Pnv~RWf~TVinqP~fk~v~g~~kl~e   48 (256)
                      +.+.++....++..++..+|++.+|+.+|.++|.|+.++...++||
T Consensus        76 ~~~~~~~~~~~~~~~~~~~p~l~~w~~~~~~~p~~~~~~~~~~~~~  121 (123)
T cd03181          76 GALLLGFTYVFDKEWRAKYPNVTRWFNTVVNQPIFKAVFGEVKLCE  121 (123)
T ss_pred             HHHHHHHHHHcCHHHHHhChHHHHHHHHHHcCHHHHHHcCCCCcCC
Confidence            4455565566787778899999999999999999999999999998


No 4  
>cd03204 GST_C_GDAP1 GST_C family, Ganglioside-induced differentiation-associated protein 1 (GDAP1) subfamily; GDAP1 was originally identified as a highly expressed gene at the differentiated stage of GD3 synthase-transfected cells. More recently, mutations in GDAP1 have been reported to cause both axonal and demyelinating autosomal-recessive Charcot-Marie-Tooth (CMT) type 4A neuropathy. CMT is characterized by slow and progressive weakness and atrophy of muscles. Sequence analysis of GDAP1 shows similarities and differences with GSTs; it appears to contain both N-terminal thioredoxin-fold and C-terminal alpha helical domains of GSTs, however, it also contains additional C-terminal transmembrane domains unlike GSTs. GDAP1 is mainly expressed in neuronal cells and is localized in the mitochondria through its transmembrane domains. It does not exhibit GST activity using standard substrates.
Probab=91.36  E-value=0.11  Score=41.99  Aligned_cols=34  Identities=21%  Similarity=0.283  Sum_probs=24.1

Q ss_pred             chhhHHHHhCChhh--hhcCCchHHHHHHHhhCcch
Q 025218            4 NLYYGFKLIMTKSF--TSEFPHVERYFWTVANQPKI   37 (256)
Q Consensus         4 ~L~~~f~~vld~e~--Rk~~Pnv~RWf~TVinqP~f   37 (256)
                      .+.++...-++..+  +.+||||.||+.+|.+.|.|
T Consensus        76 ~l~~~~~~~~~~~~~~~~~~P~l~~w~~rv~aRpsf  111 (111)
T cd03204          76 TLHRLKFLGLSRRYWGNGKRPNLEAYFERVLQRESF  111 (111)
T ss_pred             HHHHHHHcCccccccccccChHHHHHHHHHHcCCCC
Confidence            34444433345443  57899999999999999865


No 5  
>cd03187 GST_C_Phi GST_C family, Class Phi subfamily; composed of plant-specific class Phi GSTs and related fungal and bacterial proteins. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Phi GST subfamily has experience extensive gene duplication. The Arabidopsis and Oryza genomes contain 13 and 16 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Tau GSTs, showing class specificity in substrate preference. Phi enzymes a
Probab=91.25  E-value=0.15  Score=39.12  Aligned_cols=27  Identities=26%  Similarity=0.486  Sum_probs=23.2

Q ss_pred             hhhhhcCCchHHHHHHHhhCcchhhhc
Q 025218           15 KSFTSEFPHVERYFWTVANQPKIKKFL   41 (256)
Q Consensus        15 ~e~Rk~~Pnv~RWf~TVinqP~fk~v~   41 (256)
                      ...+..||++.||+++|.+.|.++.++
T Consensus        92 ~~~~~~~p~l~~~~~~~~~~p~~~~~~  118 (118)
T cd03187          92 AKLFDSRPHVKAWWEDISARPAWKKVL  118 (118)
T ss_pred             hhhhhcCchHHHHHHHHHhCHHHHhhC
Confidence            445788999999999999999998753


No 6  
>PF00043 GST_C:  Glutathione S-transferase, C-terminal domain;  InterPro: IPR004046 In eukaryotes, glutathione S-transferases (GSTs) participate in the detoxification of reactive electrophillic compounds by catalysing their conjugation to glutathione. The GST domain is also found in S-crystallins from squid, and proteins with no known GST activity, such as eukaryotic elongation factors 1-gamma and the HSP26 family of stress-related proteins, which include auxin-regulated proteins in plants and stringent starvation proteins in Escherichia coli. The major lens polypeptide of cephalopods is also a GST [, , , ]. Bacterial GSTs of known function often have a specific, growth-supporting role in biodegradative metabolism: epoxide ring opening and tetrachlorohydroquinone reductive dehalogenation are two examples of the reactions catalysed by these bacterial GSTs. Some regulatory proteins, like the stringent starvation proteins, also belong to the GST family [, ]. GST seems to be absent from Archaea in which gamma-glutamylcysteine substitute to glutathione as major thiol. Glutathione S-transferases form homodimers, but in eukaryotes can also form heterodimers of the A1 and A2 or YC1 and YC2 subunits. The homodimeric enzymes display a conserved structural fold. Each monomer is composed of a distinct N-terminal sub-domain, which adopts the thioredoxin fold, and a C-terminal all-helical sub-domain. This entry is the C-terminal domain.; PDB: 3UAP_A 3UAR_A 3QAV_A 3QAW_A 1Y6E_A 1U88_B 4AI6_B 1UA5_A 4AKH_A 3QMZ_S ....
Probab=90.42  E-value=0.15  Score=37.71  Aligned_cols=31  Identities=16%  Similarity=0.239  Sum_probs=22.0

Q ss_pred             chhhHHHHhCChhhhhcCCchHHHHHHHhhCc
Q 025218            4 NLYYGFKLIMTKSFTSEFPHVERYFWTVANQP   35 (256)
Q Consensus         4 ~L~~~f~~vld~e~Rk~~Pnv~RWf~TVinqP   35 (256)
                      .+.++...-.+.. ++.||+|.+|+++|.++|
T Consensus        65 ~~~~~~~~~~~~~-~~~~P~l~~w~~~~~~~P   95 (95)
T PF00043_consen   65 MLDWLERLGPDFL-FEKFPKLKKWYERMFARP   95 (95)
T ss_dssp             HHHHHHHHTTTTT-HTTSHHHHHHHHHHHTSH
T ss_pred             HHHHHHHhCCCcc-cccCHHHHHHHHHHHcCC
Confidence            3344444433333 689999999999999987


No 7  
>cd03178 GST_C_Ure2p_like GST_C family, Ure2p-like subfamily; composed of the Saccharomyces cerevisiae Ure2p and related GSTs. Ure2p is a regulator for nitrogen catabolism in yeast. It represses the expression of several gene products involved in the use of poor nitrogen sources when rich sources are available. A transmissible conformational change of Ure2p results in a prion called [Ure3], an inactive, self-propagating and infectious amyloid. Ure2p displays a GST fold containing an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain. The N-terminal thioredoxin-fold domain is sufficient to induce the [Ure3] phenotype and is also called the prion domain of Ure2p. In addition to its role in nitrogen regulation, Ure2p confers protection to cells against heavy metal ion and oxidant toxicity, and shows glutathione (GSH) peroxidase activity. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of GSH with a wide range of en
Probab=90.37  E-value=0.16  Score=38.79  Aligned_cols=28  Identities=25%  Similarity=0.483  Sum_probs=23.8

Q ss_pred             ChhhhhcCCchHHHHHHHhhCcchhhhc
Q 025218           14 TKSFTSEFPHVERYFWTVANQPKIKKFL   41 (256)
Q Consensus        14 d~e~Rk~~Pnv~RWf~TVinqP~fk~v~   41 (256)
                      +..++..||++.+|+.+|.++|.++.++
T Consensus        85 ~~~~~~~~p~l~~w~~~~~~~p~~~~~~  112 (113)
T cd03178          85 GIDDLDDFPNVKRWLDRIAARPAVQRGL  112 (113)
T ss_pred             cccchhhchHHHHHHHHHhhCHHHHHhc
Confidence            3335788999999999999999999864


No 8  
>cd03207 GST_C_8 GST_C family, unknown subfamily 8; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=90.17  E-value=0.15  Score=38.62  Aligned_cols=26  Identities=15%  Similarity=0.415  Sum_probs=23.0

Q ss_pred             hhhcCCchHHHHHHHhhCcchhhhcC
Q 025218           17 FTSEFPHVERYFWTVANQPKIKKFLG   42 (256)
Q Consensus        17 ~Rk~~Pnv~RWf~TVinqP~fk~v~g   42 (256)
                      ++..+|++.||+.+|.+.|.++.+..
T Consensus        76 ~~~~~p~l~~w~~~~~~~p~~~~~~~  101 (103)
T cd03207          76 LLPERPAFDAYIARITDRPAFQRAAA  101 (103)
T ss_pred             CCCCChHHHHHHHHHHcCHHHHHHhc
Confidence            46789999999999999999988753


No 9  
>cd03188 GST_C_Beta GST_C family, Class Beta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Unlike mammalian GSTs which detoxify a broad range of compounds, the bacterial class Beta GSTs exhibit limited GSH conjugating activity with a narrow range of substrates. In addition to GSH conjugation, they also bind antibiotics and reduce the antimicrobial activity of beta-lactam drugs. The structure of the Proteus mirabilis enzyme reveals that the cysteine in the active site for
Probab=89.65  E-value=0.18  Score=38.37  Aligned_cols=24  Identities=29%  Similarity=0.602  Sum_probs=21.2

Q ss_pred             hhcCCchHHHHHHHhhCcchhhhc
Q 025218           18 TSEFPHVERYFWTVANQPKIKKFL   41 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v~   41 (256)
                      ...||+|.+|+.+|.++|.++.++
T Consensus        91 ~~~~p~l~~w~~~~~~~p~~k~~~  114 (114)
T cd03188          91 LSDWPNLAAYLARVAARPAVQAAL  114 (114)
T ss_pred             hhhChHHHHHHHHHHhCHHhHhhC
Confidence            357999999999999999998863


No 10 
>cd03185 GST_C_Tau GST_C family, Class Tau subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The plant-specific class Tau GST subfamily has undergone extensive gene duplication. The Arabidopsis and Oryza genomes contain 28 and 40 Tau GSTs, respectively. They are primarily responsible for herbicide detoxification together with class Phi GSTs, showing class specificity in substrate preference. Tau enzymes are highly efficient in detoxifying diphenylether and aryloxyphenoxypropi
Probab=88.95  E-value=0.27  Score=38.36  Aligned_cols=27  Identities=15%  Similarity=0.151  Sum_probs=24.4

Q ss_pred             hhcCCchHHHHHHHhhCcchhhhcCCc
Q 025218           18 TSEFPHVERYFWTVANQPKIKKFLGDF   44 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v~g~~   44 (256)
                      ++.||++.+|+.+|.++|.++.+....
T Consensus        90 ~~~~p~l~~w~~~~~~~p~~~~~~~~~  116 (126)
T cd03185          90 EEKTPLLAAWAERFLELEAVKEVLPDR  116 (126)
T ss_pred             cccCchHHHHHHHHHhccHHHHhCCCH
Confidence            678999999999999999999987764


No 11 
>cd03203 GST_C_Lambda GST_C family, Class Lambda subfamily; composed of plant-specific class Lambda GSTs. GSTs are cytosolic, usually dimeric, proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Lambda subfamily was recently discovered, together with dehydroascorbate reductases (DHARs), as two outlying groups of the GST superfamily in Arabidopsis thaliana, which contain conserved active site cysteines. Characterization of recombinant A. thaliana proteins show that Lambda class GSTs are monomeric, similar
Probab=87.95  E-value=0.35  Score=38.42  Aligned_cols=30  Identities=10%  Similarity=0.101  Sum_probs=25.0

Q ss_pred             ChhhhhcCCchHHHHHHHhhCcchhhhcCC
Q 025218           14 TKSFTSEFPHVERYFWTVANQPKIKKFLGD   43 (256)
Q Consensus        14 d~e~Rk~~Pnv~RWf~TVinqP~fk~v~g~   43 (256)
                      +-.+...||+|.+|+.+|.+.|.++.+..+
T Consensus        82 ~~~~~~~~P~l~~W~~~~~~rp~~~~~~~~  111 (120)
T cd03203          82 NYDITEGRPNLAAWIEEMNKIEAYTQTKQD  111 (120)
T ss_pred             CccccccCcHHHHHHHHHhcchHHHhHcCC
Confidence            334457899999999999999999998664


No 12 
>cd03183 GST_C_Theta GST_C family, Class Theta subfamily; composed of eukaryotic class Theta GSTs and bacterial dichloromethane (DCM) dehalogenase. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Mammalian class Theta GSTs show poor GSH conjugating activity towards the standard substrates, CDNB and ethacrynic acid, differentiating them from other mammalian GSTs. GSTT1-1 shows similar cataytic activity as bacterial DCM dehalogenase, catalyzing the GSH-dependent hydrolytic dehalogenatio
Probab=87.52  E-value=0.34  Score=38.01  Aligned_cols=30  Identities=10%  Similarity=0.056  Sum_probs=24.7

Q ss_pred             CChhhhhcCCchHHHHHHHhh--CcchhhhcC
Q 025218           13 MTKSFTSEFPHVERYFWTVAN--QPKIKKFLG   42 (256)
Q Consensus        13 ld~e~Rk~~Pnv~RWf~TVin--qP~fk~v~g   42 (256)
                      .+.+..+.||+|.+|+.+|.+  +|.++.+.+
T Consensus        90 ~~~~~~~~~p~l~~w~~~~~~~~~p~~~~~~~  121 (126)
T cd03183          90 AGYDVFEGRPKLAAWRKRVKEAGNPLFDEAHK  121 (126)
T ss_pred             cCCcccccCchHHHHHHHHHHhcchhHHHHHH
Confidence            344456889999999999999  999988654


No 13 
>cd03196 GST_C_5 GST_C family, unknown subfamily 5; composed of uncharacterized bacterial proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=87.12  E-value=0.33  Score=38.30  Aligned_cols=23  Identities=22%  Similarity=0.478  Sum_probs=21.1

Q ss_pred             hhcCCchHHHHHHHhhCcchhhh
Q 025218           18 TSEFPHVERYFWTVANQPKIKKF   40 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v   40 (256)
                      +..||++.||+.+|.+.|.++++
T Consensus        92 ~~~~P~L~~w~~r~~~rpa~~~~  114 (115)
T cd03196          92 QSPYPRLRRWLNGFLASPLFSKI  114 (115)
T ss_pred             cccCHHHHHHHHHHHcChHHHhh
Confidence            47899999999999999999875


No 14 
>cd03210 GST_C_Pi GST_C family, Class Pi subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Pi GST is a homodimeric eukaryotic protein. The human GSTP1 is mainly found in erythrocytes, kidney, placenta and fetal liver. It is involved in stress responses and in cellular proliferation pathways as an inhibitor of JNK (c-Jun N-terminal kinase). Following oxidative stress, monomeric GSTP1 dissociates from JNK and dimerizes, losing its ability to bind JNK and causing an incre
Probab=86.38  E-value=0.56  Score=37.33  Aligned_cols=34  Identities=18%  Similarity=0.357  Sum_probs=27.9

Q ss_pred             hhhhhcCCchHHHHHHHhhCcchhhhcCCccccc
Q 025218           15 KSFTSEFPHVERYFWTVANQPKIKKFLGDFKQAE   48 (256)
Q Consensus        15 ~e~Rk~~Pnv~RWf~TVinqP~fk~v~g~~kl~e   48 (256)
                      ......||+|.+|+++|.+.|.++.++..-..+.
T Consensus        84 ~~~~~~~P~l~~~~~rv~~~p~v~~~~~~~~~~~  117 (126)
T cd03210          84 PGCLDAFPLLKAFVERLSARPKLKAYLESDAFKN  117 (126)
T ss_pred             hHhhhcChHHHHHHHHHHhCcHHHHHHhCcCCCC
Confidence            3446789999999999999999999886654444


No 15 
>cd03191 GST_C_Zeta GST_C family, Class Zeta subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Zeta GSTs, also known as maleylacetoacetate (MAA) isomerases, catalyze the isomerization of MAA to fumarylacetoacetate, the penultimate step in tyrosine/phenylalanine catabolism, using GSH as a cofactor. They show little GSH-conjugating activity towards traditional GST substrates, but display modest GSH peroxidase activity. They are also implicated in the detoxification of th
Probab=86.15  E-value=0.48  Score=36.86  Aligned_cols=25  Identities=16%  Similarity=0.198  Sum_probs=22.4

Q ss_pred             hhcCCchHHHHHHHhhCcchhhhcC
Q 025218           18 TSEFPHVERYFWTVANQPKIKKFLG   42 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v~g   42 (256)
                      ...||+|.+|+.+|.++|.|+.+..
T Consensus        94 ~~~~p~l~~w~~~~~~~p~~~~~~~  118 (121)
T cd03191          94 LSPYPTIARINEACLELPAFQAAHP  118 (121)
T ss_pred             cccCcHHHHHHHHHHhChhHHHhCc
Confidence            3789999999999999999998754


No 16 
>cd03209 GST_C_Mu GST_C family, Class Mu subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Mu subfamily is composed of eukaryotic GSTs. In rats, at least six distinct class Mu subunits have been identified, with homologous genes in humans for five of these subunits. Class Mu GSTs can form homodimers and heterodimers, giving a large number of possible isoenzymes that can be formed, all with overlapping activities but different substrate specificities. They are the m
Probab=85.39  E-value=0.57  Score=36.86  Aligned_cols=31  Identities=16%  Similarity=0.384  Sum_probs=25.5

Q ss_pred             hhhhcCCchHHHHHHHhhCcchhhhcCCccc
Q 025218           16 SFTSEFPHVERYFWTVANQPKIKKFLGDFKQ   46 (256)
Q Consensus        16 e~Rk~~Pnv~RWf~TVinqP~fk~v~g~~kl   46 (256)
                      .....||+|.+|+.+|.+.|.+++++..=..
T Consensus        82 ~~~~~~P~l~~~~~rv~~~p~vk~~~~~~~~  112 (121)
T cd03209          82 DCLDAFPNLKDFLERFEALPKISAYMKSDRF  112 (121)
T ss_pred             cccccChHHHHHHHHHHHCHHHHHHHhcccC
Confidence            3356899999999999999999998755433


No 17 
>cd03190 GST_C_ECM4_like GST_C family, ECM4-like subfamily; composed of predominantly uncharacterized and taxonomically diverse proteins with similarity to the translation product of the Saccharomyces cerevisiae gene ECM4.  ECM4, a gene of unknown function, is involved in cell surface biosynthesis and architecture. S. cerevisiae ECM4 mutants show increased amounts of the cell wall hexose, N-acetylglucosamine. More recently, global gene expression analysis shows that ECM4 is upregulated during genotoxic conditions and together with the expression profiles of 18 other genes could potentially differentiate between genotoxic and cytotoxic insults in yeast.
Probab=80.69  E-value=1.1  Score=36.64  Aligned_cols=26  Identities=12%  Similarity=0.327  Sum_probs=23.6

Q ss_pred             hhcCCchHHHHHHHhhCcchhhhcCC
Q 025218           18 TSEFPHVERYFWTVANQPKIKKFLGD   43 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v~g~   43 (256)
                      ...||+|.+|+.+|.++|.+++++..
T Consensus        93 ~~~~P~L~~w~~r~~~~P~~k~~~~~  118 (142)
T cd03190          93 IRDYPNLWNYLRRLYQNPGVAETTNF  118 (142)
T ss_pred             hhhCchHHHHHHHHhcCchHhhhcCH
Confidence            45899999999999999999998775


No 18 
>cd03177 GST_C_Delta_Epsilon GST_C family, Class Delta and Epsilon subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Delta and Epsilon subfamily is made up primarily of insect GSTs, which play major roles in insecticide resistance by facilitating reductive dehydrochlorination of insecticides or conjugating them with GSH to produce water-soluble metabolites th
Probab=79.42  E-value=1.3  Score=34.40  Aligned_cols=24  Identities=17%  Similarity=0.331  Sum_probs=21.2

Q ss_pred             hhcCCchHHHHHHHhhCcchhhhc
Q 025218           18 TSEFPHVERYFWTVANQPKIKKFL   41 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v~   41 (256)
                      ...||++.+|+.+|.+.|.|++..
T Consensus        87 ~~~~p~l~~w~~~~~~~p~~~~~~  110 (118)
T cd03177          87 LSKYPNVRAWLERLKALPPYEEAN  110 (118)
T ss_pred             hhhCchHHHHHHHHHcccchHHHH
Confidence            457999999999999999999753


No 19 
>cd03198 GST_C_CLIC GST_C family, Chloride Intracellular Channel (CLIC) subfamily; composed of CLIC1-5, p64, parchorin, and similar proteins. They are auto-inserting, self-assembling intracellular anion channels involved in a wide variety of functions including regulated secretion, cell division, and apoptosis. They can exist in both water-soluble and membrane-bound states and are found in various vesicles and membranes. Biochemical studies of the C. elegans homolog, EXC-4, show that the membrane localization domain is present in the N-terminal part of the protein. The structure of soluble human CLIC1 reveals that it is monomeric and adopts a fold similar to GSTs, containing an N-terminal domain with a thioredoxin fold and a C-terminal alpha helical domain. Upon oxidation, the N-terminal domain of CLIC1 undergoes a structural change to form a non-covalent dimer stabilized by the formation of an intramolecular disulfide bond between two cysteines that are far apart in the reduced form. T
Probab=79.06  E-value=1.1  Score=37.42  Aligned_cols=25  Identities=8%  Similarity=0.149  Sum_probs=22.3

Q ss_pred             hhcCCchHHHHHHHhhCcchhhhcC
Q 025218           18 TSEFPHVERYFWTVANQPKIKKFLG   42 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinqP~fk~v~g   42 (256)
                      ...||||.||+.+|.+.|.|+.+..
T Consensus        99 ~~~~P~L~aw~~ri~aRPsfk~t~~  123 (134)
T cd03198          99 PADLTGLWRYLKNAYQREEFTNTCP  123 (134)
T ss_pred             cccCHHHHHHHHHHHCCHHHHHHcC
Confidence            3689999999999999999998754


No 20 
>cd03184 GST_C_Omega GST_C family, Class Omega subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. Class Omega GSTs show little or no GSH-conjugating activity towards standard GST substrates. Instead, they catalyze the GSH dependent reduction of protein disulfides, dehydroascorbate and monomethylarsonate, activities which are more characteristic of glutaredoxins. They contain a conserved cysteine equivalent to the first cysteine in the CXXC motif of glutaredoxins, which is a re
Probab=76.72  E-value=1.6  Score=34.49  Aligned_cols=28  Identities=18%  Similarity=0.484  Sum_probs=25.0

Q ss_pred             hhhcCCchHHHHHHHhhCcchhhhcCCc
Q 025218           17 FTSEFPHVERYFWTVANQPKIKKFLGDF   44 (256)
Q Consensus        17 ~Rk~~Pnv~RWf~TVinqP~fk~v~g~~   44 (256)
                      .++.||++.+|+.+|.++|.++.++.+.
T Consensus        87 ~~~~~p~l~~w~~r~~~~p~v~~~~~~~  114 (124)
T cd03184          87 PLDRFPKLKKWMDAMKEDPAVQAFYTDT  114 (124)
T ss_pred             CcccChHHHHHHHHhccChHHHHHhCCH
Confidence            3678999999999999999999998764


No 21 
>cd03206 GST_C_7 GST_C family, unknown subfamily 7; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=73.93  E-value=2.1  Score=32.26  Aligned_cols=21  Identities=14%  Similarity=0.449  Sum_probs=18.6

Q ss_pred             hhhcCCchHHHHHHHhhCcch
Q 025218           17 FTSEFPHVERYFWTVANQPKI   37 (256)
Q Consensus        17 ~Rk~~Pnv~RWf~TVinqP~f   37 (256)
                      .+..||++.+|+++|.++|.|
T Consensus        80 ~~~~~p~l~~~~~~~~~~p~~  100 (100)
T cd03206          80 DLEDYPAIRRWLARIEALPGF  100 (100)
T ss_pred             ChhhCcHHHHHHHHHHhCcCC
Confidence            367899999999999999975


No 22 
>cd03201 GST_C_DHAR GST_C family, Dehydroascorbate Reductase (DHAR) subfamily; composed of plant-specific DHARs, monomeric enzymes catalyzing the reduction of DHA into ascorbic acid (AsA) using glutathione as the reductant. DHAR allows plants to recycle oxidized AsA before it is lost. AsA serves as a cofactor of violaxanthin de-epoxidase in the xanthophyll cycle and as an antioxidant in the detoxification of reactive oxygen species. Because AsA is the major reductant in plants, DHAR serves to regulate their redox state. It has been suggested that a significant portion of DHAR activity is plastidic, acting to reduce the large amounts of ascorbate oxidized during hydrogen peroxide scavenging by ascorbate peroxidase. DHAR contains a conserved cysteine in its active site and in addition to its reductase activity, shows thiol transferase activity similar to glutaredoxins.
Probab=73.81  E-value=3  Score=33.39  Aligned_cols=24  Identities=13%  Similarity=0.188  Sum_probs=22.2

Q ss_pred             hcCCchHHHHHHHhhCcchhhhcC
Q 025218           19 SEFPHVERYFWTVANQPKIKKFLG   42 (256)
Q Consensus        19 k~~Pnv~RWf~TVinqP~fk~v~g   42 (256)
                      ..||+|.||+.+|.+.|.|+.++.
T Consensus        86 ~~~P~l~~w~~rl~~rps~~~t~~  109 (121)
T cd03201          86 ESLTSVKSYMKALFSRESFVKTKA  109 (121)
T ss_pred             ccchHHHHHHHHHHCCchhhhcCC
Confidence            789999999999999999998765


No 23 
>cd03208 GST_C_Alpha GST_C family, Class Alpha subfamily; GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain. The class Alpha subfamily is composed of vertebrate GSTs which can form homodimer and heterodimers. There are at least six types of class Alpha GST subunits in rats, four of which have human counterparts, resulting in many possible isoenzymes with different activities, tissue distribution and substrate specificities. Human GSTA1-1 and GSTA2-2 show high GSH peroxidase activity. GS
Probab=69.42  E-value=3.1  Score=33.95  Aligned_cols=30  Identities=37%  Similarity=0.608  Sum_probs=25.4

Q ss_pred             ChhhhhcCCchHHHHHHHhhCcchhhhcCC
Q 025218           14 TKSFTSEFPHVERYFWTVANQPKIKKFLGD   43 (256)
Q Consensus        14 d~e~Rk~~Pnv~RWf~TVinqP~fk~v~g~   43 (256)
                      .......||+|.+|+.+|.++|.+++++..
T Consensus        86 ~~~~l~~~P~l~~~~~rv~~~P~vk~~~~~  115 (137)
T cd03208          86 DPSLLSDFPLLQAFKTRISNLPTIKKFLQP  115 (137)
T ss_pred             chhhhccChHHHHHHHHHHcCHHHHHHHhc
Confidence            344456899999999999999999998765


No 24 
>cd03180 GST_C_2 GST_C family, unknown subfamily 2; composed of uncharacterized bacterial proteins, with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=67.39  E-value=3.5  Score=30.92  Aligned_cols=21  Identities=24%  Similarity=0.596  Sum_probs=18.9

Q ss_pred             hhhcCCchHHHHHHHhhCcch
Q 025218           17 FTSEFPHVERYFWTVANQPKI   37 (256)
Q Consensus        17 ~Rk~~Pnv~RWf~TVinqP~f   37 (256)
                      .+..||+|.+|+.+|.++|.|
T Consensus        90 ~~~~~p~l~~~~~~~~~~p~~  110 (110)
T cd03180          90 ERPPLPHLERWYARLRARPAF  110 (110)
T ss_pred             ccccCchHHHHHHHHHhCCCC
Confidence            478899999999999999875


No 25 
>cd03186 GST_C_SspA GST_N family, Stringent starvation protein A (SspA) subfamily; SspA is a RNA polymerase (RNAP)-associated protein required for the lytic development of phage P1 and for stationary phase-induced acid tolerance of E. coli. It is implicated in survival during nutrient starvation. SspA adopts the GST fold with an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, but it does not bind glutathione (GSH) and lacks GST activity. SspA is highly conserved among gram-negative bacteria. Related proteins found in Neisseria (called RegF), Francisella and Vibrio regulate the expression of virulence factors necessary for pathogenesis.
Probab=65.58  E-value=3.6  Score=31.16  Aligned_cols=22  Identities=14%  Similarity=0.154  Sum_probs=20.1

Q ss_pred             hcCCchHHHHHHHhhCcchhhh
Q 025218           19 SEFPHVERYFWTVANQPKIKKF   40 (256)
Q Consensus        19 k~~Pnv~RWf~TVinqP~fk~v   40 (256)
                      ..+|++.+|+.+|...|.++.+
T Consensus        85 ~~~p~l~~w~~~~~~rpa~~~~  106 (107)
T cd03186          85 KQAKPLKDYMERVFARDSFQKS  106 (107)
T ss_pred             ccchHHHHHHHHHHCCHHHHHh
Confidence            4799999999999999999875


No 26 
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]
Probab=65.38  E-value=4.6  Score=35.90  Aligned_cols=27  Identities=19%  Similarity=0.450  Sum_probs=23.6

Q ss_pred             ChhhhhcCCchHHHHHHHhhCcchhhh
Q 025218           14 TKSFTSEFPHVERYFWTVANQPKIKKF   40 (256)
Q Consensus        14 d~e~Rk~~Pnv~RWf~TVinqP~fk~v   40 (256)
                      +...+++||++.||++++...|..+++
T Consensus       180 ~~~~~~~~p~v~~W~~~~~~~P~~~e~  206 (226)
T KOG0867|consen  180 TEKDFEKYPKVARWYERIQKRPAYEEA  206 (226)
T ss_pred             hhhhhhhChHHHHHHHHHHhCccHHHH
Confidence            688999999999999999988876654


No 27 
>PF13410 GST_C_2:  Glutathione S-transferase, C-terminal domain; PDB: 4DEJ_H 3IC8_A 2JL4_A 2V6K_B 3CBU_B 1JLW_B 3F6D_B 3G7I_A 3F63_A 3G7J_B ....
Probab=64.06  E-value=2.5  Score=29.63  Aligned_cols=17  Identities=6%  Similarity=0.360  Sum_probs=14.1

Q ss_pred             ChhhhhcCCchHHHHHH
Q 025218           14 TKSFTSEFPHVERYFWT   30 (256)
Q Consensus        14 d~e~Rk~~Pnv~RWf~T   30 (256)
                      +...++.||+|.+|+++
T Consensus        53 ~~~~~~~~p~l~~w~~r   69 (69)
T PF13410_consen   53 DFDLLEAYPNLRAWYER   69 (69)
T ss_dssp             TCCHHTTSHHHHHHHHH
T ss_pred             CcCccccCHHHHHHHhC
Confidence            44678999999999974


No 28 
>PLN02907 glutamate-tRNA ligase
Probab=63.18  E-value=2.8  Score=44.02  Aligned_cols=27  Identities=7%  Similarity=0.318  Sum_probs=21.6

Q ss_pred             hhhcCCchHHHHHHHhhCcc--hhhhcCC
Q 025218           17 FTSEFPHVERYFWTVANQPK--IKKFLGD   43 (256)
Q Consensus        17 ~Rk~~Pnv~RWf~TVinqP~--fk~v~g~   43 (256)
                      .+..||||.|||++|.++|.  |..+...
T Consensus       140 ~~~~yPnL~RW~erI~arPs~~~~~~~~a  168 (722)
T PLN02907        140 KSKKYQNLVRWFNSISAEYSDILNEVTAA  168 (722)
T ss_pred             ccccCHHHHHHHHHHHhCCCcchhhHHHH
Confidence            46789999999999999999  4444433


No 29 
>PF09868 DUF2095:  Uncharacterized protein conserved in archaea (DUF2095);  InterPro: IPR018662  This domain, found in various hypothetical prokaryotic proteins, has no known function. 
Probab=56.08  E-value=5.9  Score=32.87  Aligned_cols=28  Identities=21%  Similarity=0.478  Sum_probs=24.5

Q ss_pred             CCCCCCCCCCCCCcchhhhhhhhccCCC
Q 025218           95 KPKNPLDLLPPSKMILDDWKRLYSNTKS  122 (256)
Q Consensus        95 K~k~Pl~~Lp~s~f~ld~wKr~YSN~dt  122 (256)
                      |.|.|.|.+|=-..++++||++|-+.--
T Consensus         2 ~kk~p~d~~~wqeyd~eEFkkkfP~Lak   29 (128)
T PF09868_consen    2 KKKKPIDEFPWQEYDIEEFKKKFPALAK   29 (128)
T ss_pred             CCcCcccccchhHhhHHHHHHHhHHHHH
Confidence            5688999999999999999999987543


No 30 
>cd03200 GST_C_JTV1 GST_C family, JTV-1 subfamily; composed of uncharacterized proteins with similarity to the translation product of the human JTV-1 gene. Human JTV-1, a gene of unknown function, initiates within the human PMS2 gene promoter, but is transcribed from the opposite strand. PMS2 encodes a protein involved in DNA mismatch repair and is mutated in a subset of patients with hereditary nonpolyposis colon cancer. It is unknown whether the expression of JTV-1 affects that of PMS2, or vice versa, as a result of their juxtaposition. JTV-1 is up-regulated while PMS2 is down-regulated in tumor cell spheroids that show increased resistance to anticancer cytotoxic drugs compared with tumor cell monolayers indicating that suppressed DNA mismatch repair may be a mechanism for multicellular resistance to alkylating agents.
Probab=53.11  E-value=8.1  Score=29.60  Aligned_cols=17  Identities=18%  Similarity=0.323  Sum_probs=14.8

Q ss_pred             hhcCCchHHHHHHHhhC
Q 025218           18 TSEFPHVERYFWTVANQ   34 (256)
Q Consensus        18 Rk~~Pnv~RWf~TVinq   34 (256)
                      ...||||.||+.+|.+|
T Consensus        80 ~~~~p~l~~w~~r~~~~   96 (96)
T cd03200          80 SAAPANVQRWLKSCENL   96 (96)
T ss_pred             cccChHHHHHHHHHHhC
Confidence            35799999999999876


No 31 
>cd03194 GST_C_3 GST_C family, unknown subfamily 3; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins, and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=48.00  E-value=9.1  Score=30.03  Aligned_cols=20  Identities=15%  Similarity=0.527  Sum_probs=18.5

Q ss_pred             CchHHHHHHHhhCcchhhhc
Q 025218           22 PHVERYFWTVANQPKIKKFL   41 (256)
Q Consensus        22 Pnv~RWf~TVinqP~fk~v~   41 (256)
                      |++.+|+++|.+.|.+++.+
T Consensus        93 P~l~~~~~rv~~rPsv~~~~  112 (114)
T cd03194          93 PAAQAYVDALLAHPAMQEWI  112 (114)
T ss_pred             HHHHHHHHHHHCCHHHHHHH
Confidence            99999999999999998754


No 32 
>cd03195 GST_C_4 GST_C family, unknown subfamily 4; composed of uncharacterized proteins with similarity to GSTs. GSTs are cytosolic dimeric proteins involved in cellular detoxification by catalyzing the conjugation of glutathione (GSH) with a wide range of endogenous and xenobiotic alkylating agents, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress. GSTs also show GSH peroxidase activity and are involved in the synthesis of prostaglandins and leukotrienes. The GST fold contains an N-terminal thioredoxin-fold domain and a C-terminal alpha helical domain, with an active site located in a cleft between the two domains. GSH binds to the N-terminal domain while the hydrophobic substrate occupies a pocket in the C-terminal domain.
Probab=44.37  E-value=11  Score=29.36  Aligned_cols=20  Identities=15%  Similarity=0.373  Sum_probs=18.8

Q ss_pred             CchHHHHHHHhhCcchhhhc
Q 025218           22 PHVERYFWTVANQPKIKKFL   41 (256)
Q Consensus        22 Pnv~RWf~TVinqP~fk~v~   41 (256)
                      |++.+|+.+|.+.|.|+.++
T Consensus        92 p~l~ay~~r~~~rPa~~~~~  111 (114)
T cd03195          92 ERLRDYARRQWQRPSVQAWL  111 (114)
T ss_pred             HHHHHHHHHHHCCHHHHHHH
Confidence            89999999999999999875


No 33 
>KOG4420 consensus Uncharacterized conserved protein (Ganglioside-induced differentiation associated protein 1, GDAP1) [Function unknown]
Probab=44.05  E-value=12  Score=35.21  Aligned_cols=43  Identities=28%  Similarity=0.298  Sum_probs=37.5

Q ss_pred             ccchhhHHHHhCChhhhh--cCCchHHHHHHHhhCcchhhhcCCc
Q 025218            2 ICNLYYGFKLIMTKSFTS--EFPHVERYFWTVANQPKIKKFLGDF   44 (256)
Q Consensus         2 a~~L~~~f~~vld~e~Rk--~~Pnv~RWf~TVinqP~fk~v~g~~   44 (256)
                      +.+|.+.+..-|..++-.  +-|||..+|.+|...+.|+.|+|++
T Consensus       244 g~~LhRL~~Lg~e~~yw~~gsrpnle~Yf~rvrrR~sf~kvlg~~  288 (325)
T KOG4420|consen  244 GATLHRLKFLGLEKKYWEDGSRPNLESYFERVRRRFSFRKVLGDI  288 (325)
T ss_pred             HHHHHHHHHcccHHHhcccCCCccHHHHHHHHHhhhHHHHhhhhH
Confidence            346677777778888888  8999999999999999999999986


No 34 
>KOG0867 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]
Probab=42.25  E-value=4.4  Score=36.02  Aligned_cols=47  Identities=17%  Similarity=0.067  Sum_probs=39.5

Q ss_pred             hhhHHHHhCChhhhhcCCchHHHHHH-HhhCcchhhhcCCccccc-ccCC
Q 025218            5 LYYGFKLIMTKSFTSEFPHVERYFWT-VANQPKIKKFLGDFKQAE-SVPA   52 (256)
Q Consensus         5 L~~~f~~vld~e~Rk~~Pnv~RWf~T-VinqP~fk~v~g~~kl~e-~~~f   52 (256)
                      +...+......++|..+++++|||.+ +..++ .+..++|+.++. ...+
T Consensus       126 ~~~~~~~~~~~~~~~~~~~~e~~l~~~~yl~g-~~~tlADl~~~~~~~~~  174 (226)
T KOG0867|consen  126 LNPTAVKELEAKLRKALDNLERFLKTQVYLAG-DQLTLADLSLASTLSQF  174 (226)
T ss_pred             CcchhhHHHHHHHHHHHHHHHHHHccCCcccC-CcccHHHHHHhhHHHHH
Confidence            34556677788999999999999999 99999 999999999998 4333


No 35 
>PF13200 DUF4015:  Putative glycosyl hydrolase domain
Probab=39.64  E-value=23  Score=33.70  Aligned_cols=71  Identities=17%  Similarity=0.244  Sum_probs=45.2

Q ss_pred             CCceEEEEee-ecCCCcce---eEE-------eccchhhHhhhhH-Hhhh-hcceeEEEEeeCCCc-ceEEEEEEeCCCC
Q 025218          139 EGYSLWFCDY-KYNDENTV---SFV-------TLNKVSGFLQRMD-LARK-YAFGKMLIIGNEPPY-KVKGLWLFRGPEI  204 (256)
Q Consensus       139 egySlW~~~Y-ky~~El~~---~Fm-------s~Nli~Gf~QRle-~~rK-~aFg~~~v~Ge~~~~-~I~Gvw~~RGq~~  204 (256)
                      -|+-==..|| +||++...   .|-       -.+.|.+|+++.. .+++ .++-|+.|||-.-.+ +-.|    =||++
T Consensus       136 ~GFdEIqfDYIRFP~~~~~~~l~y~~~~~~~~r~~aI~~Fl~~a~~~l~~~~v~vSaDVfG~~~~~~~~~~----iGQ~~  211 (316)
T PF13200_consen  136 LGFDEIQFDYIRFPDEGRLSGLDYSENDTEESRVDAITDFLAYAREELHPYGVPVSADVFGYVAWSPDDMG----IGQDF  211 (316)
T ss_pred             cCCCEEEeeeeecCCCCcccccccCCCCCcchHHHHHHHHHHHHHHHHhHcCCCEEEEecccccccCCCCC----cCCCH
Confidence            3666667789 99994322   221       2367999999988 4554 589999999965322 2222    38998


Q ss_pred             CccccccccCc
Q 025218          205 PKFVMDECYDM  215 (256)
Q Consensus       205 p~~~~~~~~d~  215 (256)
                       . .+..++|+
T Consensus       212 -~-~~a~~vD~  220 (316)
T PF13200_consen  212 -E-KIAEYVDY  220 (316)
T ss_pred             -H-HHhhhCCE
Confidence             4 56555554


No 36 
>PF14497 GST_C_3:  Glutathione S-transferase, C-terminal domain; PDB: 3AY8_A 2UZ8_B 1V2A_C 2HNL_A 2YV9_B 3H1N_A 3FR6_A 1Q4J_B 1PA3_B 1OKT_B ....
Probab=33.47  E-value=23  Score=26.57  Aligned_cols=16  Identities=19%  Similarity=0.754  Sum_probs=13.4

Q ss_pred             hhhcCCchHHHHHHHh
Q 025218           17 FTSEFPHVERYFWTVA   32 (256)
Q Consensus        17 ~Rk~~Pnv~RWf~TVi   32 (256)
                      +.+.||||.||+++|-
T Consensus        83 ~~~~~p~L~~w~~ri~   98 (99)
T PF14497_consen   83 FPKDYPNLVRWYERIE   98 (99)
T ss_dssp             HTTTCHHHHHHHHHHH
T ss_pred             cccccHHHHHHHHhhc
Confidence            3468999999999985


No 37 
>cd03193 GST_C_Metaxin GST_C family, Metaxin subfamily; composed of metaxins and related proteins. Metaxin 1 is a component of a preprotein import complex of the mitochondrial outer membrane. It extends to the cytosol and is anchored to the mitochondrial membrane through its C-terminal domain. In mice, metaxin is required for embryonic development. In humans, alterations in the metaxin gene may be associated with Gaucher disease. Metaxin 2 binds to metaxin 1 and may also play a role in protein translocation into the mitochondria. Genome sequencing shows that a third metaxin gene also exists in zebrafish, Xenopus, chicken, and mammals. Sequence analysis suggests that all three metaxins share a common ancestry and that they possess similarity to GSTs. Also included in the subfamily are uncharacterized proteins with similarity to metaxins, including a novel GST from Rhodococcus with toluene o-monooxygenase and glutamylcysteine synthetase activities. Other members are the cadmium-inducible 
Probab=28.37  E-value=34  Score=24.97  Aligned_cols=14  Identities=21%  Similarity=0.529  Sum_probs=12.0

Q ss_pred             hhcCCchHHHHHHH
Q 025218           18 TSEFPHVERYFWTV   31 (256)
Q Consensus        18 Rk~~Pnv~RWf~TV   31 (256)
                      ...||++.+|+.+|
T Consensus        74 ~~~~p~l~~~~~r~   87 (88)
T cd03193          74 LKEYPNLVEYCERI   87 (88)
T ss_pred             HHhCcHHHHHHHHh
Confidence            45799999999886


No 38 
>PF11280 DUF3081:  Protein of unknown function (DUF3081);  InterPro: IPR021432  This family of proteins with unknown function appears to be restricted to Gammaproteobacteria. 
Probab=25.74  E-value=95  Score=23.88  Aligned_cols=35  Identities=20%  Similarity=0.431  Sum_probs=25.6

Q ss_pred             cCCCCceEEEEeeecCCCcceeEEecc----------chhhHhhhhHHh
Q 025218          136 YDPEGYSLWFCDYKYNDENTVSFVTLN----------KVSGFLQRMDLA  174 (256)
Q Consensus       136 fd~egySlW~~~Yky~~El~~~Fms~N----------li~Gf~QRle~~  174 (256)
                      .|.+||.+|..    -...|+++|.=|          +..-|++||.++
T Consensus        34 ~D~DGYtv~L~----~~~VtLtl~FHnty~~dy~~~~~~~~F~kkl~~i   78 (79)
T PF11280_consen   34 SDFDGYTVYLE----DNGVTLTLGFHNTYHLDYDQEHNYDSFLKKLKAI   78 (79)
T ss_pred             ecCCCcEEEEe----CCCEEEEEEeccceecCCCCHHHHHHHHHHHHcc
Confidence            58999999984    356788888765          366777777653


No 39 
>KOG1668 consensus Elongation factor 1 beta/delta chain [Transcription]
Probab=25.56  E-value=35  Score=31.28  Aligned_cols=30  Identities=7%  Similarity=0.181  Sum_probs=21.7

Q ss_pred             HHhCChhhhhcCCchHHHHHHHhhCcchhh
Q 025218           10 KLIMTKSFTSEFPHVERYFWTVANQPKIKK   39 (256)
Q Consensus        10 ~~vld~e~Rk~~Pnv~RWf~TVinqP~fk~   39 (256)
                      ..+..+.-+..++|..|||..|-.+-....
T Consensus        40 ~al~~ep~s~~~v~~~~w~~~l~a~~~~~~   69 (231)
T KOG1668|consen   40 AALGVEPQSARLVNAERWYSKLEALLRLLA   69 (231)
T ss_pred             hhcccCcchhhhhHHHHHHHHHHHHHHHHh
Confidence            334445557889999999998887766553


No 40 
>KOG0406 consensus Glutathione S-transferase [Posttranslational modification, protein turnover, chaperones]
Probab=23.14  E-value=58  Score=29.83  Aligned_cols=26  Identities=19%  Similarity=0.327  Sum_probs=23.2

Q ss_pred             hcCCchHHHHHHHhhCcchhhhcCCc
Q 025218           19 SEFPHVERYFWTVANQPKIKKFLGDF   44 (256)
Q Consensus        19 k~~Pnv~RWf~TVinqP~fk~v~g~~   44 (256)
                      ..+|.+++|.+.+.++|.++++.-+.
T Consensus       187 ~~~P~L~~W~~~~~~~~~V~~~~p~~  212 (231)
T KOG0406|consen  187 EETPKLIKWIKRMKEDEAVKAVLPDS  212 (231)
T ss_pred             CCCccHHHHHHHHhcChhHHhhcCCH
Confidence            46999999999999999999987664


Done!