Citrus Sinensis ID: 025226


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250------
MATRLFSRSKIPILASIVLQNLTKNPSKNFSFLAFKPKSPIVDFVAHEPILGLRQYHDGRPRGSLWRGKKLIGKEALFVILGLKRFKDDEEKLQKFIKTHVLRLLKMDIVAVLIELERQEETILAVKIFDIIRKQDWYQPDAYIYKDLIIALARTGKMNEAMQVWESMRKEDLFPDSQTYTEVIRGFLKDGSPADAMNIYEDMIKSPDPPEELPFRILLKGLLPHPLLRSKVKKDFEELFPEKHAYDPPEEIFGKL
ccccccccccHHHHHHHHHcccccccHHHHHHccccccccccHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHHHccccccccEEHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHHccccHHHHHHHHHHHHHcccccccccHHHHHHHHcccccHHHHHHHHHcccccccccccccccccccc
********SKIPILASIVLQNLTKNPSKNFSFLAFKPKSPIVDFVAHEPILGLRQYHDGRPRGSLWRGKKLIGKEALFVILGLKRFKDDEEKLQKFIKTHVLRLLKMDIVAVLIELERQEETILAVKIFDIIRKQDWYQPDAYIYKDLIIALARTGKMNEAMQVWESMRKEDLFPDSQTYTEVIRGFLKDGSPADAMNIYEDMIKSPDPPEELPFRILLKGLLPHPLLRSKVKKDFEELFPEKHAYDPPEEIFGKL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATRLFSRSKIPILASIVLQNLTKNPSKNFSFLAFKPKSPIVDFVAHEPILGLRQYHDGRPRGSLWRGKKLIGKEALFVILGLKRFKDDEEKLQKFIKTHVLRLLKMDIVAVLIELERQEETILAVKIFDIIRKQDWYQPDAYIYKDLIIALARTGKMNEAMQVWESMRKEDLFPDSQTYTEVIRGFLKDGSPADAMNIYEDMIKSPDPPEELPFRILLKGLLPHPLLRSKVKKDFEELFPEKHAYDPPEEIFGKL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Pentatricopeptide repeat-containing protein At3g46870 probableQ9STF9

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4G26, chain A
Confidence level:confident
Coverage over the Query: 28-225
View the alignment between query and template
View the model in PyMOL
Template: 4G26, chain A
Confidence level:confident
Coverage over the Query: 75-255
View the alignment between query and template
View the model in PyMOL