Citrus Sinensis ID: 025249


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MQQCLTHNNDLKIMLERDSGRPRGFGFITYADRRAMDDAIREMHGREFGDRVISVNKAQPKMGGEVSDHGYRGGGYSSGGRGSYGADRPGGQDDCFKCGRPGHWARDCPSAVGGRGGAGGSFSSRSRFGGVGVRGDYLGGGRDRYIDDRYDGGRYGDRDRYDSKDSKYGSRDRYVSDRYPPAGDRLAGDRYGGSDRYPVNGYGKERGYERDVGARAGSDRYASGGPARDDGRGYRSRAAPYDRPSRGDRPSFDRY
cHHHccccccEEEEEcccccccccCEEEECccHHHHHHHHHHHccccccccEEEEECcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
MQQCLTHNNDLKIMLERDSGRPRGFGFITYADRRAMDDAIREMHGREFGDRVIS****************************************CFKCGRPGHWARDCPS*****************************GGRDRYIDDRYDG*******************************************************************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQQCLTHNNDLKIMLERDSGRPRGFGFITYADRRAMDDAIREMHGREFGDRVISVNKAQPKMGGEVSDHGYRGGGYSSGGRGSYGADRPGGQDDCFKCGRPGHWARDCPSAVGGRGGAGGSFSSRSRFGGVGVRGDYLGGGRDRYIDDRYDGGRYGDRDRYDSKDSKYGSRDRYVSDRYPPAGDRLAGDRYGGSDRYPVNGYGKERGYERDVGARAGSDRYASGGPARDDGRGYRSRAAPYDRPSRGDRPSFDRY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SMZ, chain A
Confidence level:very confident
Coverage over the Query: 1-64
View the alignment between query and template
View the model in PyMOL
Template: 1CL4, chain A
Confidence level:confident
Coverage over the Query: 92-112
View the alignment between query and template
View the model in PyMOL
Template: 2LLI, chain A
Confidence level:probable
Coverage over the Query: 68-109
View the alignment between query and template
View the model in PyMOL