BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025266
         (255 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|2AHV|A Chain A, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 1
 pdb|2AHV|B Chain B, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 1
 pdb|2AHV|C Chain C, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 1
 pdb|2AHV|D Chain D, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 1
 pdb|2AHW|A Chain A, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 2
 pdb|2AHW|B Chain B, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 2
 pdb|2AHW|C Chain C, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 2
 pdb|2AHW|D Chain D, Crystal Structure Of Acyl-Coa Transferase From E. Coli
           O157:h7 (Ydif)- Thioester Complex With Coa- 2
          Length = 531

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 7/48 (14%)

Query: 131 EIPVVTLPEKFVLEFASALRYEINRALAVLR-------EIASGRDLKK 171
           E+P +T   K  LE    +RY   RA+  L+       EIA G DL+K
Sbjct: 446 ELPEITFSGKIALERGLDVRYITERAVFTLKEDGLHLIEIAPGVDLQK 493


>pdb|2AHU|A Chain A, Crystal Structure Of Acyl-coa Transferase (ydif) Apoenzyme
           From Escherichia Coli O157:h7.
 pdb|2AHU|B Chain B, Crystal Structure Of Acyl-coa Transferase (ydif) Apoenzyme
           From Escherichia Coli O157:h7.
 pdb|2AHU|C Chain C, Crystal Structure Of Acyl-coa Transferase (ydif) Apoenzyme
           From Escherichia Coli O157:h7.
 pdb|2AHU|D Chain D, Crystal Structure Of Acyl-coa Transferase (ydif) Apoenzyme
           From Escherichia Coli O157:h7
          Length = 531

 Score = 28.1 bits (61), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/48 (37%), Positives = 24/48 (50%), Gaps = 7/48 (14%)

Query: 131 EIPVVTLPEKFVLEFASALRYEINRALAVLR-------EIASGRDLKK 171
           E+P +T   K  LE    +RY   RA+  L+       EIA G DL+K
Sbjct: 446 ELPEITFSGKIALERGLDVRYITERAVFTLKEDGLHLIEIAPGVDLQK 493


>pdb|3COJ|X Chain X, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|A Chain A, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|B Chain B, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|C Chain C, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|D Chain D, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|E Chain E, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|F Chain F, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
 pdb|3COJ|G Chain G, Crystal Structure Of The Brct Domains Of Human Brca1 In
           Complex With A Phosphorylated Peptide From Human
           Acetyl-Coa Carboxylase 1
          Length = 235

 Score = 27.3 bits (59), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 19/74 (25%), Positives = 30/74 (40%), Gaps = 11/74 (14%)

Query: 121 ASTFINKSPPEIPVVTLPEKFVLEFASALRYEINRALAVLREIA-----------SGRDL 169
            S  +NK    +     PE+F+L +  A ++ I     +  E               R L
Sbjct: 18  GSHMVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTL 77

Query: 170 KKFLGVIAGLWLLS 183
           K FLG+  G W++S
Sbjct: 78  KYFLGIAGGKWVVS 91


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.324    0.140    0.417 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,765,724
Number of Sequences: 62578
Number of extensions: 249837
Number of successful extensions: 709
Number of sequences better than 100.0: 14
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 13
Number of HSP's that attempted gapping in prelim test: 708
Number of HSP's gapped (non-prelim): 14
length of query: 255
length of database: 14,973,337
effective HSP length: 97
effective length of query: 158
effective length of database: 8,903,271
effective search space: 1406716818
effective search space used: 1406716818
T: 11
A: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (22.0 bits)
S2: 50 (23.9 bits)