BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025282
         (255 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1YK9|A Chain A, Crystal Structure Of A Mutant Form Of The Mycobacterial
           Adenylyl Cyclase Rv1625c
          Length = 204

 Score = 28.1 bits (61), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 13/29 (44%), Positives = 16/29 (55%)

Query: 199 LPSGYAIGYVYGGWVGHYNWRYAFWGEAI 227
           L  G A G V  G VG   +RY  WG+A+
Sbjct: 104 LRVGLATGPVVAGVVGSRRFRYCVWGDAV 132


>pdb|4EYE|A Chain A, Crystal Structure Of A Probable Oxidoreductase From
           Mycobacterium Abscessus Solved By Iodide Ion Sad
 pdb|4EYE|B Chain B, Crystal Structure Of A Probable Oxidoreductase From
           Mycobacterium Abscessus Solved By Iodide Ion Sad
          Length = 342

 Score = 27.7 bits (60), Expect = 6.1,   Method: Compositional matrix adjust.
 Identities = 19/64 (29%), Positives = 29/64 (45%), Gaps = 7/64 (10%)

Query: 18  EPRTNPSVEDTGMVRNSLTLSPPKPSWFTPGRLLVIFCFINLLNYVDRGTIASNGVNGSP 77
           EP   P +E  G+VR     S P+ S   PG  ++ F FI    Y +R  +A + +  +P
Sbjct: 77  EPPFVPGIETAGVVR-----SAPEGSGIKPGDRVMAFNFIG--GYAERVAVAPSNILPTP 129

Query: 78  KNCS 81
               
Sbjct: 130 PQLD 133


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.326    0.141    0.468 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,790,409
Number of Sequences: 62578
Number of extensions: 328368
Number of successful extensions: 923
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 6
Number of HSP's that attempted gapping in prelim test: 921
Number of HSP's gapped (non-prelim): 7
length of query: 255
length of database: 14,973,337
effective HSP length: 97
effective length of query: 158
effective length of database: 8,903,271
effective search space: 1406716818
effective search space used: 1406716818
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 50 (23.9 bits)