Citrus Sinensis ID: 025302

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MVAPQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARDMFKISCRRKLVTALSMLLRNLCNSLLIGSIVLALINKETSVYMVCLCLRLLELPVWFNCLCSISACLVAATAVNSP
cccccccccccEEEEEcccccccccccccccccccccHHHHHHccCEEEEEcccccccHHHHHHHHHHcccccccEEEEcccccccHHHHHHcHHHccccccEEEEEEEEEEEEEEEECcccEEEEEEEEcccEEEcccccEEEEECcccccEEEEEEEcccccEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEccccEEEEEEHHHHHHcccHHHHHHHHHHHHHHHHHccccc
***********IQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARDMFKISCRRKLVTALSMLLRNLCNSLLIGSIVLALINKETSVYMVCLCLRLLELPVWFNCLCSISACLVAATAV***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVAPQDPREEVIQAWYMDDSDEDQRLPHHKDPKEFVSLDQLSELGVLSWRLDADNYETDEELKKIREDRGYSYMDFCEVCPEKLPNYEEKIKNFFEEHLHTDEEIRYCVAGSGYFDVRDRNEKWIRIWVKKGGMIVLPAGCYHRFTLDTDNYIKAMRLFVGDPVWTPFNRPHDHLPARDMFKISCRRKLVTALSMLLRNLCNSLLIGSIVLALINKETSVYMVCLCLRLLELPVWFNCLCSISACLVAATAVNSP

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 3 Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).probableQ8W108
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).probableQ10RE5
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase 2 Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene).probableF6HDT7

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1VR3, chain A
Confidence level:very confident
Coverage over the Query: 12-187
View the alignment between query and template
View the model in PyMOL