Citrus Sinensis ID: 025304


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-----
MATPSTKPTPLLKDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKTIKVPDGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPSGKEINALEQHIKNLLSPSTPLFFNTLYDPYREGADFVRGYPFSLREGVHTAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCMKVLFYCNM
cccccccccccccccCEEEEccccccHHHHHHHccccccEEEEEEcccccccccccccccccccccccHHHHccccccccccccccccEEEEEEECccEEEEEccccccccccccccHHHHHHHHccCCccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccEEEccccccccccccHHHHHHcccccccccCCcccccccccHHHHHHHHHHHHHHcccc
************KDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKTIKVPDGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPSGKEINALEQHIKNLLSPSTPLFFNTLYDPYREGADFVRGYPFSLREGVHTAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCMKVLFYCN*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MATPSTKPTPLLKDELDIVIPTIRNLDFLEMWRPFFEPYHLIIVQDGDPSKTIKVPDGFDYELYNRNDINRILGPKASCISFKDSACRCFGYMVSKKKYIFTIDDDCFVAKDPSGKEINALEQHIKNLLSPSTPLFFNTLYDPYREGADFVRGYPFSLREGVHTAVSHGLWLNIPDYDAPTQLVKPRERNTRYVDAVLTVPKGTLFPMCGMNLAFDRELIGPAMYFGLMGDGQPIGRYDDMWAGWCMKVLFYCNM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
UDP-arabinopyranose mutase 1 UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf). Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 90:10. Is probably active as heteromer in vivo.confidentQ8H8T0
UDP-arabinopyranose mutase 2 UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf) in vitro. Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 95:5. Is not active on other UDP-sugars (UDP-Gal, UDP-Xyl, UDP-Glc, GDP-Man and GDP-Fuc). Functions redundantly with RGP2 and is essential for proper cell walls and pollen development. Probably involved in the formation of the pectocellulosic cell wall layer intine. Is probably active as heteromer in vivo.confidentQ9LFW1
UDP-arabinopyranose mutase 1 UDP-L-arabinose mutase involved in the biosynthesis of cell wall non-cellulosic polysaccharides. Catalyzes the interconvertion of UDP-L-arabinopyranose (UDP-Arap) and UDP-L-arabinofuranose (UDP-Araf) in vitro. Preferentially catalyzes the formation of UDP-Arap from UDP-Araf. At thermodynamic equilibrium in vitro the ratio of the pyranose form over the furanose form is 95:5. Is not active on other UDP-sugars (UDP-Gal, UDP-Xyl, UDP-Glc, GDP-Man and GDP-Fuc). Functions redundantly with RGP2 and is essential for proper cell walls and pollen development. Probably involved in the formation of the pectocellulosic cell wall layer intine. Is probably active as heteromer in vivo.confidentQ9SRT9

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4FIX, chain A
Confidence level:probable
Coverage over the Query: 7-124
View the alignment between query and template
View the model in PyMOL