BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025323
(254 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4G1U|A Chain A, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv
From Yersinia Pestis
pdb|4G1U|B Chain B, X-Ray Structure Of The Bacterial Heme Transporter Hmuuv
From Yersinia Pestis
Length = 357
Score = 30.0 bits (66), Expect = 1.3, Method: Compositional matrix adjust.
Identities = 21/70 (30%), Positives = 31/70 (44%), Gaps = 9/70 (12%)
Query: 169 LAKLYLATITVGSLC--------WLCDRLFCEKISLWYFNPQGHALWHTFMGFNSYFANT 220
LA+L LA I + +LC ++ D + SLW G A W T + +S T
Sbjct: 168 LARLLLAGIAINALCGAAVGVLTYISDDQQLRQFSLWSMGSLGQAQWSTLLVASSLILPT 227
Query: 221 -FLMFCRAQQ 229
L +A+Q
Sbjct: 228 CILGLLQARQ 237
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.330 0.141 0.482
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,608,772
Number of Sequences: 62578
Number of extensions: 293960
Number of successful extensions: 539
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 539
Number of HSP's gapped (non-prelim): 1
length of query: 254
length of database: 14,973,337
effective HSP length: 97
effective length of query: 157
effective length of database: 8,903,271
effective search space: 1397813547
effective search space used: 1397813547
T: 11
A: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 50 (23.9 bits)