BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025340
(254 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3SUC|A Chain A, Crystal Structure Of The Pre-Mature Bacteriophage Phi29
Gene Product 12
Length = 772
Score = 29.3 bits (64), Expect = 2.2, Method: Composition-based stats.
Identities = 16/35 (45%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 9 MGKGASLMGNRNLETGNQINIQSSNLPLNVNGARM 43
+G+G SLM N N+ TGN+ NI S+ L+ N R+
Sbjct: 89 VGRGESLMYNENVTTGNE-NIFLSSFTLDGNNKRL 122
>pdb|3GQ7|A Chain A, Crystal Structure Of The Bacteriophage Phi29 Gene Product
12 N- Terminal Fragment
pdb|3GQ8|A Chain A, Crystal Structure Of The Bacteriophage Phi29 Gene Product
12 N- Terminal Fragment In Complex With
2-(N-Cyclohexylamino)ethane Sulfonic Acid (Ches)
pdb|3GQ9|A Chain A, Crystal Structure Of The Bacteriophage Phi29 Gene Product
12 N- Terminal Fragment In An Apo Form
pdb|3GQA|A Chain A, Crystal Structure Of The Bacteriophage Phi29 Gene Product
12 N- Terminal Fragment In Complex With Cobalt Ions
Length = 609
Score = 28.5 bits (62), Expect = 3.3, Method: Compositional matrix adjust.
Identities = 16/36 (44%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
Query: 8 QMGKGASLMGNRNLETGNQINIQSSNLPLNVNGARM 43
+G+G SLM N N+ TGN+ NI S+ L+ N R+
Sbjct: 88 SVGRGESLMYNENVTTGNE-NIFLSSFTLDGNNKRL 122
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.129 0.362
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,040,318
Number of Sequences: 62578
Number of extensions: 136393
Number of successful extensions: 251
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 250
Number of HSP's gapped (non-prelim): 3
length of query: 254
length of database: 14,973,337
effective HSP length: 97
effective length of query: 157
effective length of database: 8,903,271
effective search space: 1397813547
effective search space used: 1397813547
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)