Citrus Sinensis ID: 025350


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MQCRAVQRGRGTLFLPTTYFWSELLPFNVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILSVQYSIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLDIDDEMDEDIDTDPDLDIDSSGEIVYAM
ccccHccccccccHHHHHHHHHHHccccccccccccccccccccccccCEEcccccccccccccccccccccccccccHHccccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHccEECccccccccHHHHHHHHHHHcccccccccHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccccccccHHccccccccHHHHHcccccccccccccccEEEEc
**CRAVQRGRGTLFLPTTYFWSELLPFNVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILSVQYSIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLVVDNT****************EIMQIIAEATIPAAGTQSLNQCLNGSLDIDDEM***********IDSSGEIVYAM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQCRAVQRGRGTLFLPTTYFWSELLPFNVCHRDLKLENTLLDGSPAPRLKICDFGYSKSSVLHSQPKSTVGTPAYIAPEVLLKKEYDGKIADVWSCGVTLYVMLVGAYPFEDPEEPKNFRKTIHRILSVQYSIPDYVHISPECRHLISRIFVADPAKRISIPEIRNHEWFLKNLPADLVVDNTTNNQFEEPDQPMQSIDEIMQIIAEATIPAAGTQSLNQCLNGSLDIDDEMDEDIDTDPDLDIDSSGEIVYAM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Serine/threonine-protein kinase SAPK10 May play a role in signal transduction of hyperosmotic response.probableQ75H77
Serine/threonine-protein kinase SRK2E Activator of the abscisic acid (ABA) signaling pathway that regulates numerous ABA responses, such as stomata closure in response to drought, plant pathogens, or decreases in atmospheric relative humidity (RH). Involved in the resistance to drought by avoiding water loss. Required for the stomata closure mediated by pathogen-associated molecular pattern (PAMPs) (e.g. flg22 and LPS) of pathogenic bacteria such as P.syringae pv. tomato (Pst) and E.coli O157:H7. As a plant defense process, stomata are closed transiently in order to limit invaders, but actively reopened by bacteria after a few hours; virulent strains (e.g. Pst DC3000) are more efficient than avirulent strains (e.g. Pst DC3000 AvrRpt2) in reopening stomata. Mediates the phosphorylation and activation of the S-type anion efflux channel SLAC1, and thus promotes stomata closure. Essential for stomatal closure in response to reactive oxygen species (ROS).probableQ940H6

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
2.-.-.-Transferases.probable
2.7.-.-Transferring phosphorous-containing groups.probable
2.7.11.-Protein-serine/threonine kinases.probable
2.7.11.1Transferred entry: 2.7.11.19.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UC3, chain A
Confidence level:very confident
Coverage over the Query: 9-57,73-177,196-211
View the alignment between query and template
View the model in PyMOL