Citrus Sinensis ID: 025371

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MNAFGAFWQILPSDLRDRLQNDSKRGQLLEVILDLGRLPEARYLGEFGGKYLRSTEVSVEELEYAQSAVGEFGGDNRAGIEGTLHRISAIRSRKGAIVGLTCRVGRAVSGHIDMVYDLLHYGKSILFVGRPGVGKTTVMREIARVLSDEFQKRVVIVDTSNEIGGDGDIPHSAIGTARRMQVPEPSLQHKVMIEAVENHMPEVIIVDEIGTEAEAHACRSIAERGVMLIGTAHGEWLENIIKNPILSDLVCSVS
ccHHHHHHHHHHHHHHHHHHcccccccEEEEEEEcccccEEEECcccccEEcccccccHHHHHHHHccccccccccCEECccEEEEEcEEEEccccccEEEEEcccccccHHHHHHHHHHcccCEEEEccccccHHHHHHHHHHHcccccccEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHccccEEEEEccccHHHHHHccHHHHHHcccc
*NAFGAFWQILPSDLRDRLQNDSKRGQLLEVILDLGRLPEARYLGEFGGKYLRSTEVSVEELEYAQSAVGEFGGDNRAGIEGTLHRISAIRSRKGAIVGLTCRVGRAVSGHIDMVYDLLHYGKSILFVGRPGVGKTTVMREIARVLSDEFQKRVVIVDTSNEIGGDGDIPHSAIGTARRMQVPEPSLQHKVMIEAVENHMPEVIIVDEIGTEAEAHACRSIAERGVMLIGTAHGEWLENIIKNPILSDLVCSV*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAFGAFWQILPSDLRDRLQNDSKRGQLLEVILDLGRLPEARYLGEFGGKYLRSTEVSVEELEYAQSAVGEFGGDNRAGIEGTLHRISAIRSRKGAIVGLTCRVGRAVSGHIDMVYDLLHYGKSILFVGRPGVGKTTVMREIARVLSDEFQKRVVIVDTSNEIGGDGDIPHSAIGTARRMQVPEPSLQHKVMIEAVENHMPEVIIVDEIGTEAEAHACRSIAERGVMLIGTAHGEWLENIIKNPILSDLVCSVS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1YE8, chain A
Confidence level:very confident
Coverage over the Query: 124-243
View the alignment between query and template
View the model in PyMOL
Template: 1Z47, chain A
Confidence level:confident
Coverage over the Query: 97-246
View the alignment between query and template
View the model in PyMOL
Template: 2GZA, chain A
Confidence level:confident
Coverage over the Query: 18-247
View the alignment between query and template
View the model in PyMOL