BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025375
         (253 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3EJ6|A Chain A, Neurospora Crassa Catalase-3 Crystal Structure
 pdb|3EJ6|B Chain B, Neurospora Crassa Catalase-3 Crystal Structure
 pdb|3EJ6|C Chain C, Neurospora Crassa Catalase-3 Crystal Structure
 pdb|3EJ6|D Chain D, Neurospora Crassa Catalase-3 Crystal Structure
          Length = 688

 Score = 30.0 bits (66), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/51 (39%), Positives = 28/51 (54%), Gaps = 1/51 (1%)

Query: 176 SATSGGILDKAIDAEEKMHGDFLRLEHIEGYLELSAKTKTYFATAVSMWDA 226
           S T GG LDKA   +E++  D L++  I  YL  S   +TY A   + +DA
Sbjct: 544 STTKGGSLDKAKALKEQLEKDGLKVTVIAEYL-ASGVDQTYSAADATAFDA 593


>pdb|1G6U|A Chain A, Crystal Structure Of A Domain Swapped Dimer
 pdb|1G6U|B Chain B, Crystal Structure Of A Domain Swapped Dimer
          Length = 48

 Score = 28.1 bits (61), Expect = 5.1,   Method: Composition-based stats.
 Identities = 16/42 (38%), Positives = 29/42 (69%), Gaps = 1/42 (2%)

Query: 61  ELKAVKHESNNNTEKLAMVEQAIQSQDKRLDGLKTKITAVRA 102
           EL+A+K E  +  E+LA +E  +Q+ +K+L  LK+K+ A++ 
Sbjct: 8   ELQALKKEGFS-PEELAALESELQALEKKLAALKSKLQALKG 48


>pdb|1OQ4|A Chain A, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Azide.
 pdb|1OQ4|B Chain B, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Azide.
 pdb|1OQ4|C Chain C, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Azide.
 pdb|1OQ4|D Chain D, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Azide.
 pdb|1OQ4|E Chain E, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Azide.
 pdb|1OQ4|F Chain F, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Azide.
 pdb|1OQ7|A Chain A, The Crystal Structure Of The Iron Free (apo-)form Of
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (castor Bean).
 pdb|1OQ7|B Chain B, The Crystal Structure Of The Iron Free (apo-)form Of
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (castor Bean).
 pdb|1OQ7|C Chain C, The Crystal Structure Of The Iron Free (apo-)form Of
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (castor Bean).
 pdb|1OQ7|D Chain D, The Crystal Structure Of The Iron Free (apo-)form Of
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (castor Bean).
 pdb|1OQ7|E Chain E, The Crystal Structure Of The Iron Free (apo-)form Of
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (castor Bean).
 pdb|1OQ7|F Chain F, The Crystal Structure Of The Iron Free (apo-)form Of
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (castor Bean).
 pdb|1OQ9|A Chain A, The Crystal Structure Of The Complex Between Stearoyl Acyl
           Carrier Protein Desaturase From Ricinus Communis (Castor
           Bean) And Acetate.
 pdb|1OQB|A Chain A, The Crystal Structure Of The One-iron Form Of The Di-iron
           Center In Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (castor Bean).
 pdb|1OQB|B Chain B, The Crystal Structure Of The One-iron Form Of The Di-iron
           Center In Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (castor Bean).
 pdb|1OQB|C Chain C, The Crystal Structure Of The One-iron Form Of The Di-iron
           Center In Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (castor Bean).
 pdb|1OQB|D Chain D, The Crystal Structure Of The One-iron Form Of The Di-iron
           Center In Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (castor Bean).
 pdb|1OQB|E Chain E, The Crystal Structure Of The One-iron Form Of The Di-iron
           Center In Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (castor Bean).
 pdb|1OQB|F Chain F, The Crystal Structure Of The One-iron Form Of The Di-iron
           Center In Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (castor Bean).
 pdb|2XZ0|A Chain A, The Structure Of The 2:1 (Partially Occupied) Complex
           Between Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (Castor Bean) And Acyl Carrier Protein.
 pdb|2XZ0|B Chain B, The Structure Of The 2:1 (Partially Occupied) Complex
           Between Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (Castor Bean) And Acyl Carrier Protein.
 pdb|2XZ0|C Chain C, The Structure Of The 2:1 (Partially Occupied) Complex
           Between Stearoyl Acyl Carrier Protein Desaturase From
           Ricinus Communis (Castor Bean) And Acyl Carrier Protein.
 pdb|2XZ1|A Chain A, The Structure Of The 2:2 (Fully Occupied) Complex Between
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (Castor Bean) And Acyl Carrier Protein.
 pdb|2XZ1|B Chain B, The Structure Of The 2:2 (Fully Occupied) Complex Between
           Stearoyl Acyl Carrier Protein Desaturase From Ricinus
           Communis (Castor Bean) And Acyl Carrier Protein
          Length = 363

 Score = 28.1 bits (61), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 169 IRFVIGHSATSGGILDKAIDAEEKMHGDFLRLEHIEGYLELSAK 212
           +R   G S TS  I  +A  AEE  HGD L       YL LS +
Sbjct: 121 VRDETGASPTSWAIWTRAWTAEENRHGDLLN-----KYLYLSGR 159


>pdb|1AFR|A Chain A, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds
 pdb|1AFR|B Chain B, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds
 pdb|1AFR|C Chain C, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds
 pdb|1AFR|D Chain D, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds
 pdb|1AFR|E Chain E, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds
 pdb|1AFR|F Chain F, Stearoyl-Acyl Carrier Protein Desaturase From Castor Seeds
          Length = 345

 Score = 27.7 bits (60), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 169 IRFVIGHSATSGGILDKAIDAEEKMHGDFLRLEHIEGYLELSAK 212
           +R   G S TS  I  +A  AEE  HGD L       YL LS +
Sbjct: 103 VRDETGASPTSWAIWTRAWTAEENRHGDLL-----NKYLYLSGR 141


>pdb|2J2F|A Chain A, The T199d Mutant Of Stearoyl Acyl Carrier Protein
           Desaturase From Ricinus Communis (Castor Bean)
 pdb|2J2F|B Chain B, The T199d Mutant Of Stearoyl Acyl Carrier Protein
           Desaturase From Ricinus Communis (Castor Bean)
 pdb|2J2F|C Chain C, The T199d Mutant Of Stearoyl Acyl Carrier Protein
           Desaturase From Ricinus Communis (Castor Bean)
 pdb|2J2F|D Chain D, The T199d Mutant Of Stearoyl Acyl Carrier Protein
           Desaturase From Ricinus Communis (Castor Bean)
 pdb|2J2F|E Chain E, The T199d Mutant Of Stearoyl Acyl Carrier Protein
           Desaturase From Ricinus Communis (Castor Bean)
 pdb|2J2F|F Chain F, The T199d Mutant Of Stearoyl Acyl Carrier Protein
           Desaturase From Ricinus Communis (Castor Bean)
          Length = 363

 Score = 27.7 bits (60), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 21/44 (47%), Gaps = 5/44 (11%)

Query: 169 IRFVIGHSATSGGILDKAIDAEEKMHGDFLRLEHIEGYLELSAK 212
           +R   G S TS  I  +A  AEE  HGD L       YL LS +
Sbjct: 121 VRDETGASPTSWAIWTRAWTAEENRHGDLLN-----KYLYLSGR 159


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.319    0.132    0.384 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,022,192
Number of Sequences: 62578
Number of extensions: 255826
Number of successful extensions: 663
Number of sequences better than 100.0: 9
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 9
Number of HSP's that attempted gapping in prelim test: 663
Number of HSP's gapped (non-prelim): 9
length of query: 253
length of database: 14,973,337
effective HSP length: 97
effective length of query: 156
effective length of database: 8,903,271
effective search space: 1388910276
effective search space used: 1388910276
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 50 (23.9 bits)