BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025385
         (253 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3K5K|A Chain A, Discovery Of A 2,4-Diamino-7-Aminoalkoxy-Quinazoline As A
           Potent Inhibitor Of Histone Lysine Methyltransferase,
           G9a
 pdb|3K5K|B Chain B, Discovery Of A 2,4-Diamino-7-Aminoalkoxy-Quinazoline As A
           Potent Inhibitor Of Histone Lysine Methyltransferase,
           G9a
 pdb|3RJW|A Chain A, Crystal Structure Of Histone Lysine Methyltransferase G9a
           With An Inhibitor
 pdb|3RJW|B Chain B, Crystal Structure Of Histone Lysine Methyltransferase G9a
           With An Inhibitor
          Length = 283

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 79  HGNWNSEYVVSLKQLRLADLIEDDDHLHQHKNKDAQV 115
            G +  EYV  L     AD+ EDD +L    NKD +V
Sbjct: 150 QGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEV 186


>pdb|2O8J|A Chain A, Human Euchromatic Histone Methyltransferase 2
 pdb|2O8J|B Chain B, Human Euchromatic Histone Methyltransferase 2
 pdb|2O8J|C Chain C, Human Euchromatic Histone Methyltransferase 2
 pdb|2O8J|D Chain D, Human Euchromatic Histone Methyltransferase 2
          Length = 281

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 15/37 (40%), Positives = 19/37 (51%)

Query: 79  HGNWNSEYVVSLKQLRLADLIEDDDHLHQHKNKDAQV 115
            G +  EYV  L     AD+ EDD +L    NKD +V
Sbjct: 148 QGTFICEYVGELISDAEADVREDDSYLFDLDNKDGEV 184


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.316    0.130    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,337,900
Number of Sequences: 62578
Number of extensions: 277822
Number of successful extensions: 723
Number of sequences better than 100.0: 7
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 7
Number of HSP's that attempted gapping in prelim test: 723
Number of HSP's gapped (non-prelim): 7
length of query: 253
length of database: 14,973,337
effective HSP length: 97
effective length of query: 156
effective length of database: 8,903,271
effective search space: 1388910276
effective search space used: 1388910276
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 50 (23.9 bits)