BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025385
         (253 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|Q4G346|RR9_EMIHU 30S ribosomal protein S9, chloroplastic OS=Emiliania huxleyi
           GN=rps9 PE=3 SV=1
          Length = 131

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 25/39 (64%)

Query: 68  LITVSPSDGRWHGNWNSEYVVSLKQLRLADLIEDDDHLH 106
           +ITV+   G  + N+NSEY+ +L+   LA  +E+D  LH
Sbjct: 27  IITVNKKPGETYFNYNSEYLSTLRGPLLALGLENDYDLH 65


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.316    0.130    0.386 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 89,271,663
Number of Sequences: 539616
Number of extensions: 3445291
Number of successful extensions: 8524
Number of sequences better than 100.0: 5
Number of HSP's better than 100.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 8516
Number of HSP's gapped (non-prelim): 7
length of query: 253
length of database: 191,569,459
effective HSP length: 115
effective length of query: 138
effective length of database: 129,513,619
effective search space: 17872879422
effective search space used: 17872879422
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 60 (27.7 bits)