Citrus Sinensis ID: 025403

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---

MDRRRLLSATFLSLLALCFISETEPASFKMVNKCRRTVWPGLLSGANSPPLPTTGFELKSGKSRTITIPKSWSGRIWARTLCTHHQNQTFSCVTGDCGSQKLECAGGGAAPPATLAEFTLNGAGGLDFYDVSLVDGYNLPMLVVPKGGRGGGCGATGCLVDLNGACPAELKVAREGRGGSVACKSACEAFGDPRYCCSEAYATPDTCFPSVYSLFFKHVCPRAYSYAYDDKTSTYTCGSADYVIIFCPAPYTR

cccHHHHHHHHHHHHHHHHHcccccEEEEEEEcccccECcCECcccccccccccccccccccEEEEEccccccccEEEcEEECccccccEEEEcccccccccccccccccccccEEEEEEcccccccEEEEECcccccccEEEEEcccccccccccccccccccccccccccccccccCEEEcccccccccccccccccccccccccccccHHHHHHccccccECcccccccccEECccccEEEEEccccccc

*****LLSATFLSLLALCFISETEPASFKMVNKCRRTVWPGLLSGANSPPLPTTGFELKSGKSRTITIPKSWSGRIWARTLCTHHQNQTFSCVTGDCGSQKLECAGGGAAPPATLAEFTLNGAGGLDFYDVSLVDGYNLPMLVVPKGGRGGGCGATGCLVDLNGACPAELKVAREGRGGSVACKSACEAFGDPRYCCSEAYATPDTCFPSVYSLFFKHVCPRAYSYAYDDKTSTYTCGSADYVIIFCPAP***

xxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Thaumatin-like protein 1		probable	O80327
Thaumatin-like protein 1	May be involved in protecting plant tissues from pathogen infection.	probable	P83332
Thaumatin-like protein 1a		probable	Q9FSG7

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2AHN, chain A
Confidence level:very confident
Coverage over the Query: 26-248
View the alignment between query and template
View the model in PyMOL