BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025409
(253 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3L6A|A Chain A, Crystal Structure Of The C-Terminal Region Of Human P97
Length = 364
Score = 27.3 bits (59), Expect = 7.9, Method: Compositional matrix adjust.
Identities = 15/44 (34%), Positives = 26/44 (59%), Gaps = 2/44 (4%)
Query: 142 VEQRVEWLYAFDVHC-NSFFPMFVML-YVIHYFLSPLLMVHGFI 183
V+ +V LYA VHC NS FP ++L + +H++ ++ F+
Sbjct: 291 VDLQVSALYALQVHCYNSNFPKGMLLRFFVHFYDMEIIEEEAFL 334
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.334 0.143 0.479
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 7,382,650
Number of Sequences: 62578
Number of extensions: 281611
Number of successful extensions: 735
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 0
Number of HSP's successfully gapped in prelim test: 3
Number of HSP's that attempted gapping in prelim test: 735
Number of HSP's gapped (non-prelim): 3
length of query: 253
length of database: 14,973,337
effective HSP length: 97
effective length of query: 156
effective length of database: 8,903,271
effective search space: 1388910276
effective search space used: 1388910276
T: 11
A: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 50 (23.9 bits)