BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025410
(253 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|3HHS|A Chain A, Crystal Structure Of Manduca Sexta Prophenoloxidase
Length = 694
Score = 28.1 bits (61), Expect = 4.4, Method: Compositional matrix adjust.
Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%)
Query: 99 SAARRGRTVLPSWYPRTPL---RDITAVVRAIERRRAHLGEVEGLQMESPMSH 148
+ AR V+P PRTP+ RD TA E R A+ E G+ + H
Sbjct: 166 TQAREAAAVIPKTIPRTPIIIPRDYTATDLEEEHRLAYWREDLGINLHHWHWH 218
>pdb|3GKE|A Chain A, Crystal Structure Of Dicamba Monooxygenase
pdb|3GKE|B Chain B, Crystal Structure Of Dicamba Monooxygenase
pdb|3GKE|C Chain C, Crystal Structure Of Dicamba Monooxygenase
pdb|3GB4|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Cobalt And Dicamba
pdb|3GB4|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Cobalt And Dicamba
pdb|3GB4|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Cobalt And Dicamba
pdb|3GOB|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Cobalt And Dcsa
pdb|3GOB|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Cobalt And Dcsa
pdb|3GOB|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Cobalt And Dcsa
pdb|3GTE|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Iron
pdb|3GTE|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Iron
pdb|3GTE|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Iron
pdb|3GTS|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Iron And Dicamba
pdb|3GTS|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Iron And Dicamba
pdb|3GTS|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
Iron And Dicamba
pdb|3GL0|A Chain A, Crystal Structure Of Dicamba Monooxygenase Bound To 3,6
Dichlorosalicylic Acid (Dcsa)
pdb|3GL0|B Chain B, Crystal Structure Of Dicamba Monooxygenase Bound To 3,6
Dichlorosalicylic Acid (Dcsa)
pdb|3GL0|C Chain C, Crystal Structure Of Dicamba Monooxygenase Bound To 3,6
Dichlorosalicylic Acid (Dcsa)
pdb|3GL2|A Chain A, Crystal Structure Of Dicamba Monooxygenase Bound To
Dicamba
pdb|3GL2|B Chain B, Crystal Structure Of Dicamba Monooxygenase Bound To
Dicamba
pdb|3GL2|C Chain C, Crystal Structure Of Dicamba Monooxygenase Bound To
Dicamba
Length = 349
Score = 27.7 bits (60), Expect = 6.0, Method: Compositional matrix adjust.
Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%)
Query: 107 VLPSWYPRTPLRDITAVVRAIERRRAHLGEVEGLQ 141
VL SW + +++ VV AIERRRA++ E G++
Sbjct: 281 VLRSWQAQALVKEDKVVVEAIERRRAYV-EANGIR 314
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.315 0.131 0.371
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,455,056
Number of Sequences: 62578
Number of extensions: 233028
Number of successful extensions: 563
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 562
Number of HSP's gapped (non-prelim): 2
length of query: 253
length of database: 14,973,337
effective HSP length: 97
effective length of query: 156
effective length of database: 8,903,271
effective search space: 1388910276
effective search space used: 1388910276
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)