BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025410
         (253 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|3HHS|A Chain A, Crystal Structure Of Manduca Sexta Prophenoloxidase
          Length = 694

 Score = 28.1 bits (61), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 18/53 (33%), Positives = 24/53 (45%), Gaps = 3/53 (5%)

Query: 99  SAARRGRTVLPSWYPRTPL---RDITAVVRAIERRRAHLGEVEGLQMESPMSH 148
           + AR    V+P   PRTP+   RD TA     E R A+  E  G+ +     H
Sbjct: 166 TQAREAAAVIPKTIPRTPIIIPRDYTATDLEEEHRLAYWREDLGINLHHWHWH 218


>pdb|3GKE|A Chain A, Crystal Structure Of Dicamba Monooxygenase
 pdb|3GKE|B Chain B, Crystal Structure Of Dicamba Monooxygenase
 pdb|3GKE|C Chain C, Crystal Structure Of Dicamba Monooxygenase
 pdb|3GB4|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Cobalt And Dicamba
 pdb|3GB4|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Cobalt And Dicamba
 pdb|3GB4|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Cobalt And Dicamba
 pdb|3GOB|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Cobalt And Dcsa
 pdb|3GOB|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Cobalt And Dcsa
 pdb|3GOB|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Cobalt And Dcsa
 pdb|3GTE|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Iron
 pdb|3GTE|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Iron
 pdb|3GTE|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Iron
 pdb|3GTS|A Chain A, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Iron And Dicamba
 pdb|3GTS|B Chain B, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Iron And Dicamba
 pdb|3GTS|C Chain C, Crystal Structure Of Dicamba Monooxygenase With Non-Heme
           Iron And Dicamba
 pdb|3GL0|A Chain A, Crystal Structure Of Dicamba Monooxygenase Bound To 3,6
           Dichlorosalicylic Acid (Dcsa)
 pdb|3GL0|B Chain B, Crystal Structure Of Dicamba Monooxygenase Bound To 3,6
           Dichlorosalicylic Acid (Dcsa)
 pdb|3GL0|C Chain C, Crystal Structure Of Dicamba Monooxygenase Bound To 3,6
           Dichlorosalicylic Acid (Dcsa)
 pdb|3GL2|A Chain A, Crystal Structure Of Dicamba Monooxygenase Bound To
           Dicamba
 pdb|3GL2|B Chain B, Crystal Structure Of Dicamba Monooxygenase Bound To
           Dicamba
 pdb|3GL2|C Chain C, Crystal Structure Of Dicamba Monooxygenase Bound To
           Dicamba
          Length = 349

 Score = 27.7 bits (60), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%)

Query: 107 VLPSWYPRTPLRDITAVVRAIERRRAHLGEVEGLQ 141
           VL SW  +  +++   VV AIERRRA++ E  G++
Sbjct: 281 VLRSWQAQALVKEDKVVVEAIERRRAYV-EANGIR 314


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.131    0.371 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,455,056
Number of Sequences: 62578
Number of extensions: 233028
Number of successful extensions: 563
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 562
Number of HSP's gapped (non-prelim): 2
length of query: 253
length of database: 14,973,337
effective HSP length: 97
effective length of query: 156
effective length of database: 8,903,271
effective search space: 1388910276
effective search space used: 1388910276
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)