Citrus Sinensis ID: 025421

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250---

MAAATSGAVLNGLGSSFINGGKKSQALLAGTNRVTSSKKSVVVAALPPKKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTPLGALGL

ccHHHHHHHHHHccccccccccccHHHHcccccccccccccEECccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHccccHHHHHHccEEEcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccc

*********************************************LPPKKSWIPAVKGGGNLINPEWLDGSLPGDYGFDPLGLGKDPAFLKWYREAELIHGRWAMAAVVGIFVGQAWSGIPWFEAGADPGAIAPFSFGSLLGTQLLLMGWVESKRWVDFFNPESQSVEWATPWSRTAENFANATGEQGYPGGKFFDPLCLAGTIKDGVYIPDTEKLDRLKVAEIKHARLAMVAMLIFYFEAGQGKTPLGALGL

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Chlorophyll a-b binding protein CP24 10A, chloroplastic		probable	P27524
Chlorophyll a-b binding protein CP24 10B, chloroplastic		probable	P27525
Chlorophyll a-b binding protein CP24, chloroplastic		probable	P36494

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2WSC, chain 4
Confidence level:very confident
Coverage over the Query: 83-202,216-252
View the alignment between query and template
View the model in PyMOL