BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025429
         (253 letters)

Database: swissprot 
           539,616 sequences; 191,569,459 total letters

Searching..................................................done



>sp|P37506|YYAR_BACSU Uncharacterized protein YyaR OS=Bacillus subtilis (strain 168)
           GN=yyaR PE=4 SV=1
          Length = 173

 Score = 32.7 bits (73), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 15/39 (38%), Positives = 24/39 (61%)

Query: 197 RRGPNRYGYIANLCVAKSARRQGIASNMLYFAVESAKSN 235
           R   N Y  I ++ VAK  R++G+ + +L+ A+E AK N
Sbjct: 83  RSNWNGYALIEDIAVAKDYRKKGVGTALLHKAIEWAKEN 121


  Database: swissprot
    Posted date:  Mar 23, 2013  2:32 AM
  Number of letters in database: 191,569,459
  Number of sequences in database:  539,616
  
Lambda     K      H
   0.321    0.135    0.405 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 90,250,543
Number of Sequences: 539616
Number of extensions: 3547702
Number of successful extensions: 6744
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 6742
Number of HSP's gapped (non-prelim): 4
length of query: 253
length of database: 191,569,459
effective HSP length: 115
effective length of query: 138
effective length of database: 129,513,619
effective search space: 17872879422
effective search space used: 17872879422
T: 11
A: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 60 (27.7 bits)