Query         025433
Match_columns 253
No_of_seqs    165 out of 527
Neff          4.0 
Searched_HMMs 46136
Date          Fri Mar 29 05:46:27 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025433.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025433hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PF02309 AUX_IAA:  AUX/IAA fami 100.0 5.2E-54 1.1E-58  375.7   0.5  137   74-242    79-215 (215)
  2 PF00564 PB1:  PB1 domain;  Int  97.3 0.00073 1.6E-08   50.0   5.9   67  131-226     4-71  (84)
  3 smart00666 PB1 PB1 domain. Pho  97.1  0.0033 7.2E-08   46.5   7.5   65  131-225     4-69  (81)
  4 cd06398 PB1_Joka2 The PB1 doma  97.0  0.0029 6.3E-08   50.0   7.1   68  130-226     2-72  (91)
  5 cd06407 PB1_NLP A PB1 domain i  97.0  0.0034 7.5E-08   48.5   7.0   55  131-214     3-57  (82)
  6 cd05992 PB1 The PB1 domain is   96.7  0.0083 1.8E-07   44.1   7.1   66  131-226     3-70  (81)
  7 cd06396 PB1_NBR1 The PB1 domai  96.5   0.011 2.3E-07   46.4   6.6   53  131-213     3-55  (81)
  8 cd06401 PB1_TFG The PB1 domain  96.3   0.029 6.4E-07   44.0   8.1   72  131-229     3-78  (81)
  9 cd06409 PB1_MUG70 The MUG70 pr  95.1    0.05 1.1E-06   42.9   5.2   50  139-213     8-59  (86)
 10 cd06403 PB1_Par6 The PB1 domai  95.0   0.077 1.7E-06   41.7   5.9   72  131-230     3-76  (80)
 11 cd06404 PB1_aPKC PB1 domain is  95.0   0.085 1.8E-06   41.7   6.2   56  131-215     3-58  (83)
 12 cd06402 PB1_p62 The PB1 domain  94.7    0.11 2.4E-06   41.0   6.3   59  130-215     2-65  (87)
 13 cd06397 PB1_UP1 Uncharacterize  93.9    0.22 4.7E-06   39.3   6.2   66  131-226     3-69  (82)
 14 cd06408 PB1_NoxR The PB1 domai  86.9     2.4 5.2E-05   33.6   6.2   64  130-225     4-68  (86)
 15 cd06399 PB1_P40 The PB1 domain  68.5     9.1  0.0002   30.9   4.2   37  144-210    22-58  (92)
 16 PF10411 DsbC_N:  Disulfide bon  46.5      17 0.00036   26.0   2.1   17  199-215    34-50  (57)
 17 cd06395 PB1_Map2k5 PB1 domain   39.4      52  0.0011   26.5   4.0   49  136-213     9-57  (91)
 18 KOG4540 Putative lipase essent  36.8      22 0.00048   34.8   1.9   49  203-252   149-214 (425)
 19 COG5153 CVT17 Putative lipase   36.8      22 0.00048   34.8   1.9   49  203-252   149-214 (425)
 20 PF14688 DUF4461:  Domain of un  22.3      56  0.0012   31.1   1.9   28  198-225    82-117 (313)
 21 PF02013 CBM_10:  Cellulose or   20.8      28 0.00062   23.5  -0.3   12  199-210    16-27  (36)

No 1  
>PF02309 AUX_IAA:  AUX/IAA family;  InterPro: IPR003311 The Aux/IAA family of genes are key regulators of auxin-modified gene expression []. The plant hormone auxin (indole-3-acetic acid, IAA) regulates diverse cellular and developmental responses in plants, including cell division, expansion, differentiation and patterning of embryo responses []. Auxin can regulate the gene expression of several families, including GH3 and SAUR, as well as Aux/IAA itself. The Aux/IAA proteins act as repressors of auxin-induced gene expression, possibly through modulating the activity of DNA-binding auxin response factors (ARFs) (IPR010525 from INTERPRO). Aux/IAA and ARF are thought to interact through C-terminal protein-protein interaction domains found in both Aux/IAA and ARF. Recent evidence suggests that Aux/IAA proteins can also mediate light responses []. Some members of the AUX/IAA family are longer and contain an N-terminal DNA binding domain [] and may have an early function in the establishment of vascular and body patterns in embryonic and post-embryonic development in some plants.; GO: 0006355 regulation of transcription, DNA-dependent, 0005634 nucleus; PDB: 2P1N_F 2P1Q_C 2P1O_C.
Probab=100.00  E-value=5.2e-54  Score=375.67  Aligned_cols=137  Identities=53%  Similarity=0.896  Sum_probs=6.0

Q ss_pred             CCCCCCCccccCCcchhhcccccccCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCceEEEecCcccceeecCCCCCChH
Q 025433           74 FPTALRKVVGWPPIRSFRKNLAGASASKLPASESPNDVPSKTVDEKPAHEPGRKNPFVKINMDGVPIGRKVDLNAYDSYE  153 (253)
Q Consensus        74 ~~~a~aqVVGWPPVRSfRKN~~~~~~~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~fVKV~MDGvpIgRKVDL~~y~sY~  153 (253)
                      .|.+++|+|||||||+||||++...                        .....++||||+|||+||||||||++|+||+
T Consensus        79 ~p~~~~~~vgwpp~~s~r~n~~~~~------------------------~~~~~~~~vKV~mdG~~igRkVDL~~~~sY~  134 (215)
T PF02309_consen   79 PPASKAQVVGWPPVRSFRKNSLSEK------------------------QSSSSRSYVKVNMDGVPIGRKVDLSAYSSYE  134 (215)
T ss_dssp             -------BTTBS----S---------------------------------------------------------------
T ss_pred             CCcccccccCCCccccccccccccc------------------------ccccCCceeEEEecCcccceecCHHHhhCHH
Confidence            3456789999999999999987621                        0122378999999999999999999999999


Q ss_pred             HHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeEEcCCcChhhHhhcceEeEEecCc
Q 025433          154 KLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRMLVGDVPWHMFVSTVTRLRVLKSS  233 (253)
Q Consensus       154 eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwMLVGDVPWemFv~svKRLrImk~S  233 (253)
                      +|+.+|++||.+|.+.++++ .      ..++..+.++++++ +|+|||||+||||||||||||+|||++|||||||+.+
T Consensus       135 ~L~~~L~~MF~~~~i~~~~~-~------~~~~~~~~~~~~~~-~~~l~Y~D~egd~mlvGD~PW~~F~~~vkRl~I~~~~  206 (215)
T PF02309_consen  135 ELSSALEKMFSCFSIEQCGS-H------GLNESGLLDLLNGS-EYVLVYEDKEGDWMLVGDVPWEEFVKSVKRLRIMKSS  206 (215)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             HHHHHHHHhcCCCCcccccc-c------cccchhhccccCCc-ceeEEEECCCCCEEEecCCCHHHHHHHhhccEEecHH
Confidence            99999999998876655433 1      11112233455665 9999999999999999999999999999999999999


Q ss_pred             ccccccccc
Q 025433          234 EVSALSREK  242 (253)
Q Consensus       234 Ea~gl~~~~  242 (253)
                      |+.+|+|+.
T Consensus       207 e~~~~~~r~  215 (215)
T PF02309_consen  207 EAKGLAPRA  215 (215)
T ss_dssp             ---------
T ss_pred             HhcccCCCC
Confidence            999999973


No 2  
>PF00564 PB1:  PB1 domain;  InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.; GO: 0005515 protein binding; PDB: 1IPG_A 1IP9_A 2KFK_A 1WMH_A 1VD2_A 1WI0_A 1OEY_C 1PQS_A 1Q1O_A 1TZ1_A ....
Probab=97.29  E-value=0.00073  Score=50.01  Aligned_cols=67  Identities=24%  Similarity=0.420  Sum_probs=53.6

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      ||+.-.|. +=|.+.+..--+|++|...+++.|...                            ...+.+.|.|.||||.
T Consensus         4 vK~~~~~~-~~~~~~~~~~~s~~~L~~~i~~~~~~~----------------------------~~~~~l~Y~D~dgD~V   54 (84)
T PF00564_consen    4 VKVRYGGD-IRRIISLPSDVSFDDLRSKIREKFGLL----------------------------DEDFQLKYKDEDGDLV   54 (84)
T ss_dssp             EEEEETTE-EEEEEEECSTSHHHHHHHHHHHHHTTS----------------------------TSSEEEEEEETTSSEE
T ss_pred             EEEEECCe-eEEEEEcCCCCCHHHHHHHHHHHhCCC----------------------------CccEEEEeeCCCCCEE
Confidence            79999995 333588888889999999999999620                            1369999999999999


Q ss_pred             EcCC-cChhhHhhcceE
Q 025433          211 LVGD-VPWHMFVSTVTR  226 (253)
Q Consensus       211 LVGD-VPWemFv~svKR  226 (253)
                      .+-+ .=|++.++.+++
T Consensus        55 ~i~sd~Dl~~a~~~~~~   71 (84)
T PF00564_consen   55 TISSDEDLQEAIEQAKE   71 (84)
T ss_dssp             EESSHHHHHHHHHHHHH
T ss_pred             EeCCHHHHHHHHHHHHh
Confidence            8875 468888887753


No 3  
>smart00666 PB1 PB1 domain. Phox and Bem1p domain, present in many eukaryotic cytoplasmic signalling proteins. The domain adopts a beta-grasp fold, similar to that found in ubiquitin and Ras-binding domains. A motif, variously termed OPR, PC and AID, represents the most conserved region of the majority of PB1 domains, and is necessary for PB1 domain function. This function is the formation of PB1 domain heterodimers, although not all PB1 domain pairs associate.
Probab=97.06  E-value=0.0033  Score=46.48  Aligned_cols=65  Identities=25%  Similarity=0.378  Sum_probs=51.6

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      |||.-.|.  -|.+-+..--+|++|.+.+.+.|..                           . ...+.|.|+|.||||.
T Consensus         4 vK~~~~~~--~~~~~~~~~~s~~dL~~~i~~~~~~---------------------------~-~~~~~l~Y~Dedgd~v   53 (81)
T smart00666        4 VKLRYGGE--TRRLSVPRDISFEDLRSKVAKRFGL---------------------------D-NQSFTLKYQDEDGDLV   53 (81)
T ss_pred             EEEEECCE--EEEEEECCCCCHHHHHHHHHHHhCC---------------------------C-CCCeEEEEECCCCCEE
Confidence            78887553  6778888889999999999999962                           0 1368999999999998


Q ss_pred             EcCC-cChhhHhhcce
Q 025433          211 LVGD-VPWHMFVSTVT  225 (253)
Q Consensus       211 LVGD-VPWemFv~svK  225 (253)
                      .+.+ .=|++.++.++
T Consensus        54 ~l~sd~Dl~~a~~~~~   69 (81)
T smart00666       54 SLTSDEDLEEAIEEYD   69 (81)
T ss_pred             EecCHHHHHHHHHHHH
Confidence            7665 57777777665


No 4  
>cd06398 PB1_Joka2 The PB1 domain is present in the Nicotiana plumbaginifolia Joka2 protein which interacts with sulfur stress inducible UP9 protein. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module
Probab=97.01  E-value=0.0029  Score=49.96  Aligned_cols=68  Identities=21%  Similarity=0.294  Sum_probs=51.6

Q ss_pred             ceEEEecCcccceeecCC---CCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCC
Q 025433          130 FVKINMDGVPIGRKVDLN---AYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNE  206 (253)
Q Consensus       130 fVKV~MDGvpIgRKVDL~---~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkE  206 (253)
                      -|||+-+|.-+=-+++++   .--+|++|.+.+.+.|..                           ....+|+|.|.|.|
T Consensus         2 ~vKv~y~~~~rRf~l~~~~~~~d~~~~~L~~kI~~~f~l---------------------------~~~~~~~l~Y~Ded   54 (91)
T cd06398           2 VVKVKYGGTLRRFTFPVAENQLDLNMDGLREKVEELFSL---------------------------SPDADLSLTYTDED   54 (91)
T ss_pred             EEEEEeCCEEEEEEeccccccCCCCHHHHHHHHHHHhCC---------------------------CCCCcEEEEEECCC
Confidence            489999998444455543   467999999999999962                           11247999999999


Q ss_pred             CCeEEcCCcChhhHhhcceE
Q 025433          207 GDRMLVGDVPWHMFVSTVTR  226 (253)
Q Consensus       207 GDwMLVGDVPWemFv~svKR  226 (253)
                      |||...-+.  +++...+.+
T Consensus        55 gd~V~l~~D--~DL~~a~~~   72 (91)
T cd06398          55 GDVVTLVDD--NDLTDAIQY   72 (91)
T ss_pred             CCEEEEccH--HHHHHHHHH
Confidence            999998776  666666655


No 5  
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium). The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes like osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-inte
Probab=96.97  E-value=0.0034  Score=48.55  Aligned_cols=55  Identities=18%  Similarity=0.278  Sum_probs=43.3

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      |||...|.  -+.+-|..--+|++|.+.+.++|..                           +..+.|.|.|.|.||||.
T Consensus         3 vK~~~~~d--~~r~~l~~~~~~~~L~~~i~~r~~~---------------------------~~~~~f~LkY~Ddegd~v   53 (82)
T cd06407           3 VKATYGEE--KIRFRLPPSWGFTELKQEIAKRFKL---------------------------DDMSAFDLKYLDDDEEWV   53 (82)
T ss_pred             EEEEeCCe--EEEEEcCCCCCHHHHHHHHHHHhCC---------------------------CCCCeeEEEEECCCCCeE
Confidence            89999886  5556666666999999999999962                           011479999999999998


Q ss_pred             EcCC
Q 025433          211 LVGD  214 (253)
Q Consensus       211 LVGD  214 (253)
                      ++--
T Consensus        54 ~lts   57 (82)
T cd06407          54 LLTC   57 (82)
T ss_pred             Eeec
Confidence            7643


No 6  
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as a noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=96.72  E-value=0.0083  Score=44.05  Aligned_cols=66  Identities=23%  Similarity=0.312  Sum_probs=51.3

Q ss_pred             eEEEecCcccceeecCC-CCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCe
Q 025433          131 VKINMDGVPIGRKVDLN-AYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDR  209 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~-~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDw  209 (253)
                      |||+-.|.  -|.+=+. .--+|++|.+.|.+.|...                            ...+.+.|+|.||||
T Consensus         3 vK~~~~~~--~~~~~~~~~~~s~~~L~~~i~~~~~~~----------------------------~~~~~l~y~D~e~d~   52 (81)
T cd05992           3 VKVKYGGE--IRRFVVVSRSISFEDLRSKIAEKFGLD----------------------------AVSFKLKYPDEDGDL   52 (81)
T ss_pred             EEEEecCC--CEEEEEecCCCCHHHHHHHHHHHhCCC----------------------------CCcEEEEeeCCCCCE
Confidence            78888774  4555555 8889999999999999620                            136899999999999


Q ss_pred             EEcCC-cChhhHhhcceE
Q 025433          210 MLVGD-VPWHMFVSTVTR  226 (253)
Q Consensus       210 MLVGD-VPWemFv~svKR  226 (253)
                      ..+.+ .=|++-++.+++
T Consensus        53 v~l~sd~Dl~~a~~~~~~   70 (81)
T cd05992          53 VTISSDEDLEEAIEEARR   70 (81)
T ss_pred             EEeCCHHHHHHHHHHHhh
Confidence            98887 577777777653


No 7  
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The NBR1 protein contains a type I PB1 domain.
Probab=96.49  E-value=0.011  Score=46.36  Aligned_cols=53  Identities=19%  Similarity=0.293  Sum_probs=44.9

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      |||.-.|.-+--+++-+..-+|++|.+.+.++|+-                           +   .|.+.|-|.||||.
T Consensus         3 vKaty~~d~~rf~~~~~~~~~~~~L~~ev~~rf~l---------------------------~---~f~lKYlDde~e~v   52 (81)
T cd06396           3 LKVTYNGESQSFLVSDSENTTWASVEAMVKVSFGL---------------------------N---DIQIKYVDEENEEV   52 (81)
T ss_pred             EEEEECCeEEEEEecCCCCCCHHHHHHHHHHHhCC---------------------------C---cceeEEEcCCCCEE
Confidence            78999998777777777788999999999999951                           2   58999999999998


Q ss_pred             EcC
Q 025433          211 LVG  213 (253)
Q Consensus       211 LVG  213 (253)
                      ++-
T Consensus        53 ~ls   55 (81)
T cd06396          53 SVN   55 (81)
T ss_pred             EEE
Confidence            763


No 8  
>cd06401 PB1_TFG The PB1 domain found in TFG protein, an oncogenic gene product and fusion partner to nerve growth factor tyrosine kinase receptor TrkA and to the tyrosine kinase ALK. The PB1 domain is a modular domain mediating specific protein-protein interaction in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The PB1 domains of TFG represent a type I/II PB1 domain. The physiological function of TFG remains unknown.
Probab=96.29  E-value=0.029  Score=44.03  Aligned_cols=72  Identities=22%  Similarity=0.437  Sum_probs=49.0

Q ss_pred             eEEEecCcccceeecCCCC-CChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCe
Q 025433          131 VKINMDGVPIGRKVDLNAY-DSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDR  209 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y-~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDw  209 (253)
                      +|+.-+|.  -|++=+..- -+|.+|...+++.|..-                         +..+..+.+.|.|.|||+
T Consensus         3 iK~~~g~D--iR~~~~~~~~~t~~~L~~~v~~~F~~~-------------------------~~~~~~flIKYkD~dGDl   55 (81)
T cd06401           3 LKAQLGDD--IRRIPIHNEDITYDELLLMMQRVFRGK-------------------------LGSSDDVLIKYKDEDGDL   55 (81)
T ss_pred             EEEEeCCe--EEEEeccCccccHHHHHHHHHHHhccc-------------------------cCCcccEEEEEECCCCCE
Confidence            67777663  455544443 39999999999999731                         112457999999999999


Q ss_pred             EEcCCc---ChhhHhhcceEeEE
Q 025433          210 MLVGDV---PWHMFVSTVTRLRV  229 (253)
Q Consensus       210 MLVGDV---PWemFv~svKRLrI  229 (253)
                      .-+.+-   -|..=....+||+|
T Consensus        56 VTIts~~dL~~A~~~~~~~~l~~   78 (81)
T cd06401          56 ITIFDSSDLSFAIQCSRILKLTL   78 (81)
T ss_pred             EEeccHHHHHHHHhcCcceEEEE
Confidence            999874   34433334445554


No 9  
>cd06409 PB1_MUG70 The MUG70 protein is a product of the meiotically up-regulated gene 70 which has a role in meiosis and harbors a PB1 domain. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domains depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic amino acid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is
Probab=95.11  E-value=0.05  Score=42.94  Aligned_cols=50  Identities=28%  Similarity=0.421  Sum_probs=36.2

Q ss_pred             ccceeecC--CCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeEEcC
Q 025433          139 PIGRKVDL--NAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRMLVG  213 (253)
Q Consensus       139 pIgRKVDL--~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwMLVG  213 (253)
                      |-||.+=+  ....|+.+|.+++.+=|+.-                       .  ...+.|.|.|.|.||||.+.-
T Consensus         8 ~~GrvhRf~~~~s~~~~~L~~~I~~Rl~~d-----------------------~--~~~~~~~L~YlDDEgD~VllT   59 (86)
T cd06409           8 PKGRVHRFRLRPSESLEELRTLISQRLGDD-----------------------D--FETHLYALSYVDDEGDIVLIT   59 (86)
T ss_pred             CCCCEEEEEecCCCCHHHHHHHHHHHhCCc-----------------------c--ccCCcccEEEEcCCCCEEEEe
Confidence            45665444  44789999999999988520                       0  002469999999999999864


No 10 
>cd06403 PB1_Par6 The PB1 domain is an essential part of Par6 protein which in complex with Par3 and aPKC proteins is crucial for establishment of apical-basal polarity of animal cells. The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants. The
Probab=94.98  E-value=0.077  Score=41.66  Aligned_cols=72  Identities=21%  Similarity=0.295  Sum_probs=50.9

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      ||.+-|+.=-=-.+|.....+|+++++-|+.||..                           . .-.|++-|.|.+||.+
T Consensus         3 VKSkfdaEfRRFsl~r~~~~~f~ef~~ll~~lH~l---------------------------~-~~~f~i~Y~D~~gDLL   54 (80)
T cd06403           3 VKSKFDAEFRRFSLDRNKPGKFEDFYKLLEHLHHI---------------------------P-NVDFLIGYTDPHGDLL   54 (80)
T ss_pred             eecccCCeEEEEEeccccCcCHHHHHHHHHHHhCC---------------------------C-CCcEEEEEeCCCCCEe
Confidence            66666765222234555569999999999999962                           1 1369999999999999


Q ss_pred             EcC-CcChhhHhhcceE-eEEe
Q 025433          211 LVG-DVPWHMFVSTVTR-LRVL  230 (253)
Q Consensus       211 LVG-DVPWemFv~svKR-LrIm  230 (253)
                      -+- |+-...=++++++ |||.
T Consensus        55 PInNDdNf~kAlssa~plLRl~   76 (80)
T cd06403          55 PINNDDNFLKALSSANPLLRIF   76 (80)
T ss_pred             cccCcHHHHHHHHcCCCceEEE
Confidence            765 5566666677775 4443


No 11 
>cd06404 PB1_aPKC PB1 domain is an essential modular domain of the atypical protein kinase C (aPKC) which in complex with Par6 and Par3  proteins is crucial for establishment of apical-basal polarity of animal cells. PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi,
Probab=94.98  E-value=0.085  Score=41.66  Aligned_cols=56  Identities=27%  Similarity=0.328  Sum_probs=42.8

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      ||+.-.|.-.--.+|.  .-+|++|.+.+.+||.-                          .. ...|++.|.|.|||--
T Consensus         3 ~K~~y~gdi~it~~d~--~~s~e~L~~~v~~~c~~--------------------------~~-~q~ft~kw~DEEGDp~   53 (83)
T cd06404           3 VKAAYNGDIMITSIDP--SISLEELCNEVRDMCRF--------------------------HN-DQPFTLKWIDEEGDPC   53 (83)
T ss_pred             EEEEecCcEEEEEcCC--CcCHHHHHHHHHHHhCC--------------------------CC-CCcEEEEEECCCCCce
Confidence            7888899755445555  77899999999999962                          11 1369999999999987


Q ss_pred             EcCCc
Q 025433          211 LVGDV  215 (253)
Q Consensus       211 LVGDV  215 (253)
                      -+...
T Consensus        54 tiSS~   58 (83)
T cd06404          54 TISSQ   58 (83)
T ss_pred             eecCH
Confidence            66653


No 12 
>cd06402 PB1_p62 The PB1 domain is an essential part of p62 scaffold protein (alias sequestosome 1,SQSTM) involved in cell signaling, receptor internalization, and protein turnover. The PB1 domain is a modular domain mediating specific protein-protein interaction which play roles in many critical cell processes. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions. The PB1 domain module is conserved in amoebas, fungi, animals, and plants.
Probab=94.72  E-value=0.11  Score=41.03  Aligned_cols=59  Identities=29%  Similarity=0.429  Sum_probs=42.0

Q ss_pred             ceEEEecC---cccceeecC--CCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEec
Q 025433          130 FVKINMDG---VPIGRKVDL--NAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYED  204 (253)
Q Consensus       130 fVKV~MDG---vpIgRKVDL--~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYED  204 (253)
                      .||.+..|   .+=-|++-|  ....+|++|.+.+.++|..                          +.+ ..|++.|.|
T Consensus         2 ~vkayl~~~~~~~EIRRf~l~~~~~~s~~~L~~~V~~~f~~--------------------------l~~-~~ftlky~D   54 (87)
T cd06402           2 TVKAYLLGKDANAEIRRFAIDEDVSTSYEYLVEKVAAVFPS--------------------------LRG-KNFQLFWKD   54 (87)
T ss_pred             eEEEeecCCCCccceEEEEecCCCCcCHHHHHHHHHHHccc--------------------------cCC-CcEEEEEEC
Confidence            56777666   233344444  6667999999999999952                          111 379999999


Q ss_pred             CCCCeEEcCCc
Q 025433          205 NEGDRMLVGDV  215 (253)
Q Consensus       205 kEGDwMLVGDV  215 (253)
                      .|||..-....
T Consensus        55 eeGDlvtIssd   65 (87)
T cd06402          55 EEGDLVAFSSD   65 (87)
T ss_pred             CCCCEEeecCH
Confidence            99998876653


No 13 
>cd06397 PB1_UP1 Uncharacterized protein 1. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. Interactions of PB1 domains with other protein domains have been described as noncanonical PB1-interactions.
Probab=93.89  E-value=0.22  Score=39.35  Aligned_cols=66  Identities=18%  Similarity=0.310  Sum_probs=50.9

Q ss_pred             eEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          131 VKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       131 VKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      -||+-+|.  .|++....-=+|.+|.+.|+.+|...                           .. .+.++|-|.|||..
T Consensus         3 fKv~~~g~--~RRf~~~~~pt~~~L~~kl~~Lf~lp---------------------------~~-~~~vtYiDeD~D~I   52 (82)
T cd06397           3 FKSSFLGD--TRRIVFPDIPTWEALASKLENLYNLP---------------------------EI-KVGVTYIDNDNDEI   52 (82)
T ss_pred             EEEEeCCc--eEEEecCCCccHHHHHHHHHHHhCCC---------------------------hh-HeEEEEEcCCCCEE
Confidence            48888885  89999888899999999999999631                           01 38999999999987


Q ss_pred             EcC-CcChhhHhhcceE
Q 025433          211 LVG-DVPWHMFVSTVTR  226 (253)
Q Consensus       211 LVG-DVPWemFv~svKR  226 (253)
                      -+- |.=-++|.+-..|
T Consensus        53 Tlssd~eL~d~~~~~~~   69 (82)
T cd06397          53 TLSSNKELQDFYRLSHR   69 (82)
T ss_pred             EecchHHHHHHHHhccc
Confidence            554 4556666654444


No 14 
>cd06408 PB1_NoxR The PB1 domain is present in the Epichloe festucae NoxR protein (NADPH oxidase regulator), a key regulator of NADPH oxidase isoform, NoxA.  NoxA is essential for growth control of the fungal endophyte in plant tissue in the process of symbiotic interaction between a fungi and its plant host.   The Epichloe festucae p67(phox)-like regulator, NoxR, dispensable in culture but essential in plants for the symbiotic interaction. Plants infected with a noxR deletion mutant show severe stunting and premature senescence, whereas hyphae in the meristematic tissues show increased branching leading to increased fungal colonization of pseudostem and leaf blade tissue.  The PB1 domain is a modular domain mediating specific protein-protein interactions which a play role in many critical cell processes such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domains, is 
Probab=86.95  E-value=2.4  Score=33.60  Aligned_cols=64  Identities=17%  Similarity=0.298  Sum_probs=49.1

Q ss_pred             ceEEEecCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCe
Q 025433          130 FVKINMDGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDR  209 (253)
Q Consensus       130 fVKV~MDGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDw  209 (253)
                      =|||+-.|.  .|-|-+..-=+|++|...+.++|+.                             ...+++-|.|. ||.
T Consensus         4 kVKv~~~~D--v~~i~v~~~i~f~dL~~kIrdkf~~-----------------------------~~~~~iKykDE-GD~   51 (86)
T cd06408           4 RVKVHAQDD--TRYIMIGPDTGFADFEDKIRDKFGF-----------------------------KRRLKIKMKDD-GDM   51 (86)
T ss_pred             EEEEEecCc--EEEEEcCCCCCHHHHHHHHHHHhCC-----------------------------CCceEEEEEcC-CCC
Confidence            488888887  6677777777899999999999961                             13689999999 999


Q ss_pred             EEcCCc-ChhhHhhcce
Q 025433          210 MLVGDV-PWHMFVSTVT  225 (253)
Q Consensus       210 MLVGDV-PWemFv~svK  225 (253)
                      .-++|- =-++=+.++|
T Consensus        52 iti~sq~DLd~Ai~~a~   68 (86)
T cd06408          52 ITMGDQDDLDMAIDTAR   68 (86)
T ss_pred             ccccCHHHHHHHHHHHH
Confidence            888874 3445555554


No 15 
>cd06399 PB1_P40 The PB1 domain is essential part of the p40 adaptor protein which plays an important role in activating phagocyte NADPH oxidase during phagocytosis. The PB1 domain is a modular domain mediating specific protein-protein interaction which play a role in many critical cell processes , such as osteoclastogenesis, angiogenesis, early cardiovascular development and cell polarity. A canonical PB1-PB1 interaction, which involves heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster. The PB1 domain of p40 represents a type I PB1 domain which interacts with the PB1 domain of oxidase activator p67 w
Probab=68.46  E-value=9.1  Score=30.92  Aligned_cols=37  Identities=27%  Similarity=0.386  Sum_probs=29.8

Q ss_pred             ecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeE
Q 025433          144 VDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRM  210 (253)
Q Consensus       144 VDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwM  210 (253)
                      =||+.--+|.+|..-..+-|..                              .+-.|-|.|.|||..
T Consensus        22 e~l~~~P~~kdLl~lmr~~f~~------------------------------~dIaLNYrD~EGDLI   58 (92)
T cd06399          22 EDLSSTPLLKDLLELTRREFQR------------------------------EDIALNYRDAEGDLI   58 (92)
T ss_pred             cccccCccHHHHHHHHHHHhch------------------------------hheeeeeecCCCCEE
Confidence            3788888999998888888852                              245899999999974


No 16 
>PF10411 DsbC_N:  Disulfide bond isomerase protein N-terminus;  InterPro: IPR018950  This is the N-terminal domain of the disulphide bond isomerase DsbC. The whole molecule is V-shaped, where each arm is a DsbC monomer of two domains linked by a hinge; and the N-termini of each monomer join to form the dimer interface at the base of the V, so are vital for dimerisation []. DsbC is required for disulphide bond formation and functions as a disulphide bond isomerase during oxidative protein-folding in bacterial periplasm. It also has chaperone activity []. ; PDB: 1EEJ_B 2IYJ_A 1TJD_A 1JZD_B 1JZO_A 1G0T_B 1T3B_A.
Probab=46.48  E-value=17  Score=26.02  Aligned_cols=17  Identities=24%  Similarity=0.698  Sum_probs=14.6

Q ss_pred             EEEEecCCCCeEEcCCc
Q 025433          199 TLVYEDNEGDRMLVGDV  215 (253)
Q Consensus       199 vltYEDkEGDwMLVGDV  215 (253)
                      .+.|.|.||+.+++|+.
T Consensus        34 ~i~Y~~~dg~yli~G~l   50 (57)
T PF10411_consen   34 GILYVDEDGRYLIQGQL   50 (57)
T ss_dssp             EEEEEETTSSEEEES-E
T ss_pred             eEEEEcCCCCEEEEeEE
Confidence            58899999999999984


No 17 
>cd06395 PB1_Map2k5 PB1 domain is essential part of the mitogen-activated protein kinase kinase 5 (Map2k5, alias MEK5) one of the key member of the signaling kinases cascade which involved in angiogenesis and early cardiovascular development. The PB1 domain of Map2k5 interacts with the PB1 domain of another members of kinase cascade MEKK2 (or MEKK3).  A canonical PB1-PB1 interaction, involving heterodimerization of two PB1 domain, is required for the formation of macromolecular signaling complexes ensuring specificity and fidelity during cellular signaling. The interaction between two PB1 domain depends on the type of PB1. There are three types of PB1 domains: type I which contains an OPCA motif, acidic aminoacid cluster, type II which contains a basic cluster, and type I/II which contains both an OPCA motif and a basic cluster.  The Map2k5 protein contains a type I PB1 domain.
Probab=39.40  E-value=52  Score=26.46  Aligned_cols=49  Identities=18%  Similarity=0.363  Sum_probs=33.0

Q ss_pred             cCcccceeecCCCCCChHHHHHHHHHHhhhhhhcccCCCCCCccchhhhHHhhhccCCCCCceEEEEecCCCCeEEcC
Q 025433          136 DGVPIGRKVDLNAYDSYEKLSAAVDELFRGLLAAQRDSSAGGIVNKQEEEKAITGVLDGSGEYTLVYEDNEGDRMLVG  213 (253)
Q Consensus       136 DGvpIgRKVDL~~y~sY~eL~~aLe~MF~~~~~~q~~ss~~~~~~~~ee~~~~~~ll~gs~eyvltYEDkEGDwMLVG  213 (253)
                      +|..+--.||....=++.++..++.+....                             ..--.+-|||.|||+.-|-
T Consensus         9 ~gg~vDw~V~~~~~L~F~DvL~~I~~vlp~-----------------------------aT~tAFeYEDE~gDRITVR   57 (91)
T cd06395           9 NGGAVDWTVQSGPQLLFRDVLDVIGQVLPE-----------------------------ATTTAFEYEDEDGDRITVR   57 (91)
T ss_pred             CCCcccccccCcccccHHHHHHHHHHhccc-----------------------------ccccceeeccccCCeeEec
Confidence            344556667777777888888877765531                             0122566999999988764


No 18 
>KOG4540 consensus Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking, secretion, and vesicular transport; Lipid transport and metabolism]
Probab=36.78  E-value=22  Score=34.84  Aligned_cols=49  Identities=29%  Similarity=0.393  Sum_probs=39.4

Q ss_pred             ecCCCCeEEcCCcChh-----------------hHhhcceEeEEecCcccccccccccCcchhhhcc
Q 025433          203 EDNEGDRMLVGDVPWH-----------------MFVSTVTRLRVLKSSEVSALSREKFGNSRQDKIL  252 (253)
Q Consensus       203 EDkEGDwMLVGDVPWe-----------------mFv~svKRLrImk~SEa~gl~~~~~~~~~~~~~~  252 (253)
                      .+-||||.-||. ||.                 .|-+-++-+-|++.....-++...-+-|++||+.
T Consensus       149 ip~dgdw~nv~~-~wn~T~pe~FGwdgDGlRghVF~nd~~~vv~~~~kgtSi~Gl~g~gTs~kDk~n  214 (425)
T KOG4540|consen  149 IPLDGDWRNVTE-PWNETVPETFGWDGDGLRGHVFGNDGKIVVAFKGKGTSIMGLEGGGTSRKDKLN  214 (425)
T ss_pred             CCCCCcccccCC-CcccCCccccCcCCCCceeeeeccCCceEEEEEeccceEEeeccCCccccccch
Confidence            388999999985 676                 5888889888888888777777666678888874


No 19 
>COG5153 CVT17 Putative lipase essential for disintegration of autophagic bodies inside the vacuole [Intracellular trafficking and secretion / Lipid metabolism]
Probab=36.78  E-value=22  Score=34.84  Aligned_cols=49  Identities=29%  Similarity=0.393  Sum_probs=39.4

Q ss_pred             ecCCCCeEEcCCcChh-----------------hHhhcceEeEEecCcccccccccccCcchhhhcc
Q 025433          203 EDNEGDRMLVGDVPWH-----------------MFVSTVTRLRVLKSSEVSALSREKFGNSRQDKIL  252 (253)
Q Consensus       203 EDkEGDwMLVGDVPWe-----------------mFv~svKRLrImk~SEa~gl~~~~~~~~~~~~~~  252 (253)
                      .+-||||.-||. ||.                 .|-+-++-+-|++.....-++...-+-|++||+.
T Consensus       149 ip~dgdw~nv~~-~wn~T~pe~FGwdgDGlRghVF~nd~~~vv~~~~kgtSi~Gl~g~gTs~kDk~n  214 (425)
T COG5153         149 IPLDGDWRNVTE-PWNETVPETFGWDGDGLRGHVFGNDGKIVVAFKGKGTSIMGLEGGGTSRKDKLN  214 (425)
T ss_pred             CCCCCcccccCC-CcccCCccccCcCCCCceeeeeccCCceEEEEEeccceEEeeccCCccccccch
Confidence            388999999985 676                 5888889888888888777777666678888874


No 20 
>PF14688 DUF4461:  Domain of unknown function (DUF4461)
Probab=22.30  E-value=56  Score=31.08  Aligned_cols=28  Identities=39%  Similarity=0.824  Sum_probs=20.5

Q ss_pred             eEEEEe-----cCCCCeEE-cCCcC--hhhHhhcce
Q 025433          198 YTLVYE-----DNEGDRML-VGDVP--WHMFVSTVT  225 (253)
Q Consensus       198 yvltYE-----DkEGDwML-VGDVP--WemFv~svK  225 (253)
                      .+|++-     |.+|+.|| +||||  |..|++.+.
T Consensus        82 ~tvvF~~~sGv~~~G~v~L~~~Dv~~~W~~~l~~l~  117 (313)
T PF14688_consen   82 RTVVFGDFSGVSLDGHVMLGTGDVPHQWTSFLERLP  117 (313)
T ss_pred             CEEEecCCCccCCCCCEEecCCCcHHHHHHHHHhCC
Confidence            455554     67899887 78886  888887665


No 21 
>PF02013 CBM_10:  Cellulose or protein binding domain;  InterPro: IPR002883 This domain is found in two distinct sets of proteins with different functions. Those found in aerobic bacteria bind cellulose (or other carbohydrates); but in anaerobic fungi they are protein binding domains, referred to as dockerin domains or docking domains. They are believed to be responsible for the assembly of a multiprotein cellulase/hemicellulase complex, similar to the cellulosome found in certain anaerobic bacteria. The recycling of photosynthetically fixed carbon in plant cell walls is a key microbial process. Enzyme systems that attack the plant cell wall contain noncatalytic carbohydrate-binding modules that mediate attachment to this composite structure and play a pivotal role in maximizing the hydrolytic process. In anaerobes, the degradation is carried out by a high molecular weight, multifunctional complex termed the cellulosome. This consists of a number of independent enzyme components, each of which contains a conserved 40-residue dockerin domain, which functions to bind the enzyme to a cohesin domain within the scaffoldin protein [, ].  In anaerobic bacteria that degrade plant cell walls, exemplified by Clostridium thermocellum, the dockerin domains of the catalytic polypeptides can bind equally well to any cohesin from the same organism. More recently, anaerobic fungi, typified by Piromyces equi, have been suggested to also synthesise a cellulosome complex, although the dockerin sequences of the bacterial and fungal enzymes are completely different []. For example, the fungal enzymes contain one, two or three copies of the dockerin sequence in tandem within the catalytic polypeptide. In contrast, all the C. thermocellum cellulosome catalytic components contain a single dockerin domain. The anaerobic bacterial dockerins are homologous to EF hands (calcium-binding motifs) and require calcium for activity whereas the fungal dockerin does not require calcium. Finally, the interaction between cohesin and dockerin appears to be species specific in bacteria, there is almost no species specificity of binding within fungal species and no identified sites that distinguish different species.  The structure of dockerin from P. equi contains two helical stretches and four short beta-strands which form an antiparallel sheet structure adjacent to an additional short twisted parallel strand. The N- and C-termini are adjacent to each other.  Aerobic bacteria contain related regions, however these appear to function as cellulose/carbohydrate binding domains.; GO: 0004553 hydrolase activity, hydrolyzing O-glycosyl compounds, 0005975 carbohydrate metabolic process; PDB: 2J4M_A 2J4N_A 1E8R_A 1QLD_A 1E8P_A 1E8Q_A.
Probab=20.82  E-value=28  Score=23.49  Aligned_cols=12  Identities=33%  Similarity=0.667  Sum_probs=8.8

Q ss_pred             EEEEecCCCCeE
Q 025433          199 TLVYEDNEGDRM  210 (253)
Q Consensus       199 vltYEDkEGDwM  210 (253)
                      .+.|.|.+|+|=
T Consensus        16 ~v~y~d~~g~WG   27 (36)
T PF02013_consen   16 EVVYTDDDGGWG   27 (36)
T ss_dssp             --SEEETTEEEE
T ss_pred             ceEEcCCCCCEe
Confidence            678999999983


Done!