Citrus Sinensis ID: 025454

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MADYHFVYKDVEGASTQWDDIQRKLGNLPPKPPAFKPSAFEPAVDPDSVPKDKSWVDEKTEEELEELEDDPDLDDDRFLEEYRKKRLAEMREATKISRFGSVMPISGSDFVREVSQAPPDVWVVVILYKDGFAECGLLMQCLEELARKYPATKFVKIISTDCIPNYPDRNLPTVLVYNNGAVKANYVGLRSFGRRCTPEGVALVLCQSDPVLNDGQSGSDPSRKTVLEGVRKRLIEKVVAEHEDDDDGSSSD
ccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEcccccHHHHHHcccccEEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEccccccccccccccEEEEEEccCEEEEEEccccccccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHccccccccccccccc
***YHFVYKDVEGASTQWDDIQRKLGNL****************************************DDPDLDDDRFLEEYRK**************FGSVMPISGSDFVREVSQAPPDVWVVVILYKDGFAECGLLMQCLEELARKYPATKFVKIISTDCIPNYPDRNLPTVLVYNNGAVKANYVGLRSFGRRCTPEGVALVLCQSDP******************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADYHFVYKDVEGASTQWDDIQRKLGNLPPKPPAFKPSAFEPAVDPDSVPKDKSWVDEKTEEELEELEDDPDLDDDRFLEEYRKKRLAEMREATKISRFGSVMPISGSDFVREVSQAPPDVWVVVILYKDGFAECGLLMQCLEELARKYPATKFVKIISTDCIPNYPDRNLPTVLVYNNGAVKANYVGLRSFGRRCTPEGVALVLCQSDPVLNDGQSGSDPSRKTVLEGVRKRLIEKVVAEHEDDDDGSSSD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Viral IAP-associated factor homolog Modulates the activation of caspases during apoptosis.probableQ8MR62
Phosducin-like protein 3 Modulates the activation of caspases during apoptosis.probableQ5RB77
Phosducin-like protein 3 Modulates the activation of caspases during apoptosis. Is a substrate for Orgyia pseudotsugata multicapsid polyhedrosis virus (OpMNPV) IAP-mediated ubiquitination.probableQ9H2J4

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1A0R, chain P
Confidence level:very confident
Coverage over the Query: 52-214
View the alignment between query and template
View the model in PyMOL