Citrus Sinensis ID: 025503

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--

MEKEREHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTSDLPEEGGECYKFLSSLPS

cccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccc

*****EHHVYLARLAEQAERYDEMVEAMKKVAKLDVELTVEERNLVSVGYKNVIGARRASWRILSS**************KRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYYEILNSPERACHLAKQAFDEAIAELDSLNEESYKDSTLIMQLLRDNLTLWTS******************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MEKEREHHVYxxxxxxxxxxxxxxxxxxxxxAKLDVELTVEERNLVSVGYKNVIGARRASWRILSSIEQKEEAKGNEQNVKRIKEYRQRVEDELAKICNDILSVIDEHLIPSSTSGESTVFYYKMKGDYYRYLAEFKGADDRKEAADHSLKAYEAATAAAASELPPTHPIRLGLALNFSVFYYEILNSPERAxxxxxxxxxxxxxxxxxxxxxSYKDSTLIMQLLRDNLTLWTSDLPEEGGECYKFLSSLPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
DNA damage checkpoint protein rad24	Required for the DNA damage checkpoint that ensures that DNA damage is repaired before mitosis is attempted. Acts as a negative regulator of meiosis by antagonizing the function of mei2. It inhibits the association of meiRNA (a non-coding RNA molecule required for the nuclear mei2 dot formation) to the phosphorylated but not to the unphosphorylated form of mei2 in vitro.	confident	P42656
14-3-3-like protein C		confident	Q96452
14-3-3 protein epsilon	Positively regulates Ras-mediated pathways. Acts downstream or parallel to Raf, but upstream of nuclear factors in Ras signaling. Three mutants have been isolated, that suppress the rough eye phenotype caused by mutated Ras1 (sev-Ras1 v12). Inhibits yki activity by restricting its nuclear localization.	confident	P92177

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3UZD, chain A
Confidence level:very confident
Coverage over the Query: 4-233
View the alignment between query and template
View the model in PyMOL