Citrus Sinensis ID: 025511


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MGIFSNRVILKTYIFDIHRVLEGYESSTRKDTRANSLLLILVCLCTSFLFLLSFSLLFDMFDLKADEAARESRQSKQDRYTEMRRRKDEEREARESALEEEAKAQKAREEEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEISVA
cccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHcccccEEECccccEEEEcHHHHHHHHHHHHHcccccHHHHHHHccccccccccHHHHHHHHHHHHHHcc
**IFSNRVILKTYIFDIHRVLEGYESSTRKDTRANSLLLILVCLCTSFLFLLSFSLLFDMFDLK****************************************************FEKWKGEFS**************DRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFV*****V******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGIFSNRVILKTYIFDIHRVLEGYESSTRKDTRANSLLLILVCLCTSFLFLLSFSLLFDMFDLKADEAARESxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxEAAAFEFEKWKGEFSIDAEGTTENEVQDGDRDLLADFVEYIKKHKCIPLEDLAAEFKLRTQECINRITSLENMGRLSGVMDDRGKYIYISQAEMKAVADYIKRQGRVSISHLASKSNQFIDLETKAQFVEDLSGVEEISVA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
DDRGK domain-containing protein 1 probableQ8LH03
DDRGK domain-containing protein 1 probableQ94C53

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1WI9, chain A
Confidence level:very confident
Coverage over the Query: 138-206
View the alignment between query and template
View the model in PyMOL
Template: 3LMM, chain A
Confidence level:probable
Coverage over the Query: 145-204
View the alignment between query and template
View the model in PyMOL
Template: 3CUQ, chain B
Confidence level:probable
Coverage over the Query: 115-227
View the alignment between query and template
View the model in PyMOL
Template: 3LVG, chain D
Confidence level:probable
Coverage over the Query: 67-144
View the alignment between query and template
View the model in PyMOL