BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025532
         (251 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1JHF|A Chain A, Lexa G85d Mutant
 pdb|1JHF|B Chain B, Lexa G85d Mutant
          Length = 202

 Score = 28.5 bits (62), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%)

Query: 59  EGIPSVASVQADEPYVGQQFESEXXXXXXXXXXXTRVGFVIRVSKLS 105
           EG+P V  V ADEP + QQ   E               F++RVS +S
Sbjct: 74  EGLPLVGRVAADEPLLAQQ-HIEGHYQVDPSLFKPNADFLLRVSGMS 119


>pdb|2YNM|A Chain A, Structure Of The Adpxalf3-stabilized Transition State Of
           The Nitrogenase-like Dark-operative Protochlorophyllide
           Oxidoreductase Complex From Prochlorococcus Marinus With
           Its Substrate Protochlorophyllide A
 pdb|2YNM|B Chain B, Structure Of The Adpxalf3-stabilized Transition State Of
           The Nitrogenase-like Dark-operative Protochlorophyllide
           Oxidoreductase Complex From Prochlorococcus Marinus With
           Its Substrate Protochlorophyllide A
          Length = 301

 Score = 27.7 bits (60), Expect = 6.7,   Method: Compositional matrix adjust.
 Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 7/71 (9%)

Query: 188 NEHDKIRELSQQLALEKKRAANYKRHLELIV-------EQIEEHNESLAKKIQHVVDSVK 240
           N+ D I  +++ +A    +A NYK  L  ++       +QIE+ NE    K      +V 
Sbjct: 182 NDFDSIFAMNRIVAAINAKAKNYKVRLGGVIANRSAELDQIEKFNEKTGLKTMAHFRNVD 241

Query: 241 NIEDEEQKSCT 251
            I     K CT
Sbjct: 242 AIRRSRLKKCT 252


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.314    0.132    0.371 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,870,371
Number of Sequences: 62578
Number of extensions: 253718
Number of successful extensions: 531
Number of sequences better than 100.0: 12
Number of HSP's better than 100.0 without gapping: 2
Number of HSP's successfully gapped in prelim test: 10
Number of HSP's that attempted gapping in prelim test: 525
Number of HSP's gapped (non-prelim): 15
length of query: 251
length of database: 14,973,337
effective HSP length: 96
effective length of query: 155
effective length of database: 8,965,849
effective search space: 1389706595
effective search space used: 1389706595
T: 11
A: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 50 (23.9 bits)