Query         025532
Match_columns 251
No_of_seqs    206 out of 557
Neff          5.6 
Searched_HMMs 46136
Date          Fri Mar 29 06:48:32 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025532.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025532hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 PLN03097 FHY3 Protein FAR-RED  100.0 1.9E-34 4.2E-39  294.3  16.9  173   67-248    69-255 (846)
  2 PF03101 FAR1:  FAR1 DNA-bindin  99.9 1.6E-27 3.4E-32  181.7   8.6   89   86-174     1-91  (91)
  3 PF08731 AFT:  Transcription fa  98.7 1.2E-07 2.6E-12   76.1   9.4   88   78-172     1-111 (111)
  4 PF03108 DBD_Tnp_Mut:  MuDR fam  97.9 6.8E-05 1.5E-09   54.2   7.3   63   72-161     4-67  (67)
  5 PF04500 FLYWCH:  FLYWCH zinc f  88.5       1 2.2E-05   30.8   4.5   25  143-170    38-62  (62)
  6 PF03106 WRKY:  WRKY DNA -bindi  84.4     1.4   3E-05   31.7   3.4   28  144-171    31-59  (60)
  7 COG5470 Uncharacterized conser  59.0     4.9 0.00011   31.7   1.1   30   71-100    53-82  (96)
  8 smart00774 WRKY DNA binding do  57.9      12 0.00026   26.9   2.9   28  143-170    31-59  (59)
  9 PF04684 BAF1_ABF1:  BAF1 / ABF  57.9     4.9 0.00011   39.9   1.1   42   75-122    25-66  (496)
 10 smart00461 WH1 WASP homology r  55.7     7.3 0.00016   30.7   1.6   23   70-92     81-103 (106)
 11 PF07576 BRAP2:  BRCA1-associat  53.9     8.8 0.00019   30.8   1.8   21   73-93     56-76  (110)
 12 cd00837 EVH1 EVH1 (Enabled, Va  52.9     8.3 0.00018   30.2   1.5   21   71-91     80-100 (104)
 13 cd01205 WASP WASP-type EVH1 do  49.2      10 0.00022   30.4   1.4   25   68-92     78-102 (105)
 14 PF02185 HR1:  Hr1 repeat;  Int  48.1   1E+02  0.0022   22.1   7.9   57  192-248     2-65  (70)
 15 PF00568 WH1:  WH1 domain;  Int  48.1      11 0.00023   29.8   1.4   20   73-92     89-108 (111)
 16 PF04684 BAF1_ABF1:  BAF1 / ABF  45.3      46   0.001   33.3   5.6   27  160-186   168-194 (496)
 17 PF04800 ETC_C1_NDUFA4:  ETC co  44.3      18 0.00039   28.8   2.2   26   74-103    51-76  (101)
 18 PF07045 DUF1330:  Protein of u  41.2      13 0.00028   26.5   0.9   17   74-90     42-58  (65)
 19 PF15299 ALS2CR8:  Amyotrophic   33.9      57  0.0012   29.0   4.0   17  136-152    71-87  (225)
 20 PF05377 FlaC_arch:  Flagella a  31.9 1.5E+02  0.0032   21.2   4.9   29  214-242    12-40  (55)
 21 cd01207 Ena-Vasp Enabled-VASP-  31.1      33 0.00072   27.7   1.8   21   71-91     83-103 (111)
 22 PHA02047 phage lambda Rz1-like  30.5 2.6E+02  0.0056   22.3   6.6   47  188-238    31-77  (101)
 23 PF08414 NADPH_Ox:  Respiratory  29.1      41  0.0009   26.8   2.0   26   72-98     52-77  (100)
 24 PF06295 DUF1043:  Protein of u  26.2 3.5E+02  0.0077   21.9   7.2   33  188-220    22-54  (128)
 25 PF12441 DUF3680:  Protein of u  24.9      59  0.0013   21.8   1.9   14   77-90      7-20  (42)
 26 PF01693 Cauli_VI:  Caulimoviru  24.5      45 0.00098   22.0   1.3   13   75-87     32-44  (44)
 27 PF02024 Leptin:  Leptin;  Inte  23.9 1.2E+02  0.0026   25.8   3.9   70  165-243    21-91  (146)
 28 PF08471 Ribonuc_red_2_N:  Clas  23.6      66  0.0014   25.3   2.2   17   77-93     72-88  (93)
 29 PF03670 UPF0184:  Uncharacteri  21.2 2.2E+02  0.0047   22.0   4.6   34  212-245    36-69  (83)

No 1  
>PLN03097 FHY3 Protein FAR-RED ELONGATED HYPOCOTYL 3; Provisional
Probab=100.00  E-value=1.9e-34  Score=294.27  Aligned_cols=173  Identities=23%  Similarity=0.387  Sum_probs=120.7

Q ss_pred             CCCCCCccCCccCCHHHHHHHHHHHhhhcCeeEEEeeeeeecCCCCeEeeeeeeccCCccCCCcc----h----------
Q 025532           67 VQADEPYVGQQFESEAAAHAFYNAYATRVGFVIRVSKLSRSRRDGSAIGRALVCNKEGYRLPDKR----E----------  132 (251)
Q Consensus        67 ~~~~~P~vGM~F~S~eeA~~FYn~YA~~~GF~iR~~~~~rs~~dG~i~~r~fvCsreG~r~~~k~----~----------  132 (251)
                      ....+|++||+|+|+||||+||+.||+++||+||+++++|++.+|.+++++|||+|+|++..+.+    .          
T Consensus        69 ~~~~~P~vGMeF~S~eeA~~FYn~YA~~~GFsVRi~~srrsk~~~~ii~r~fvCsreG~~~~~~~~~~~~~~~~~k~~~~  148 (846)
T PLN03097         69 DTNLEPLSGMEFESHGEAYSFYQEYARSMGFNTAIQNSRRSKTSREFIDAKFACSRYGTKREYDKSFNRPRARQTKQDPE  148 (846)
T ss_pred             CCCccCcCCCeECCHHHHHHHHHHHHhhcCceEEeeceeccCCCCcEEEEEEEEcCCCCCcccccccccccccccccCcc
Confidence            46678999999999999999999999999999999999999999999999999999998643211    0          


Q ss_pred             hhhccCcccccCCccEEEEEeecCceEEEEEecccCCCCCCCCCCCcccccccCCCchhhHHHHHHHHHHHHHHHHHHHH
Q 025532          133 KIVRQRAETRVGCRAMILVRKVNSGQWVVTKFVKEHTHPLTPGKGRKDCIYDQYPNEHDKIRELSQQLALEKKRAANYKR  212 (251)
Q Consensus       133 ~~~r~R~~tRtGC~A~i~vk~~~~gkW~V~~f~~eHNH~L~p~~~~~~~~~~~~~~shk~I~el~~el~~~~k~~~~~r~  212 (251)
                      ...++|+.+||||+|+|+|++..+|+|+|++|+++|||||.|+....       .+..+.+..+..++.....+. ..+.
T Consensus       149 ~~~~rR~~tRtGC~A~m~Vk~~~~gkW~V~~fv~eHNH~L~p~~~~~-------~~~r~~~~~~~~~~~~~~~v~-~~~~  220 (846)
T PLN03097        149 NGTGRRSCAKTDCKASMHVKRRPDGKWVIHSFVKEHNHELLPAQAVS-------EQTRKMYAAMARQFAEYKNVV-GLKN  220 (846)
T ss_pred             cccccccccCCCCceEEEEEEcCCCeEEEEEEecCCCCCCCCccccc-------hhhhhhHHHHHhhhhcccccc-ccch
Confidence            01235778999999999999988899999999999999999876421       011111111111111111000 0000


Q ss_pred             HHHHHHHHHHHhhHHHHHHHHHHHHHHHHhhhhhcc
Q 025532          213 HLELIVEQIEEHNESLAKKIQHVVDSVKNIEDEEQK  248 (251)
Q Consensus       213 ~l~~~~k~v~eh~~~ls~~i~~iv~~~k~~E~e~~~  248 (251)
                      .....+...+ ...--..|++.+++||++||.++|.
T Consensus       221 d~~~~~~~~r-~~~~~~gD~~~ll~yf~~~q~~nP~  255 (846)
T PLN03097        221 DSKSSFDKGR-NLGLEAGDTKILLDFFTQMQNMNSN  255 (846)
T ss_pred             hhcchhhHHH-hhhcccchHHHHHHHHHHHHhhCCC
Confidence            0000111000 1111236999999999999999985


No 2  
>PF03101 FAR1:  FAR1 DNA-binding domain;  InterPro: IPR004330 Phytochrome A is the primary photoreceptor for mediating various far-red light-induced responses in higher plants. It has been found that the proteins governing this response, which include FAR-RED ELONGATED HYPOCOTYL3 (FHY3) and FAR-RED-IMPAIRED RESPONSE1 (FAR1), are a pair of homologous proteins sharing significant sequence homology to mutator-like transposases. These proteins appear to be novel transcription factors, which are essential for activating the expression of FHY1 and FHL (for FHY1-like) and related genes, whose products are required for light-induced phytochrome A nuclear accumulation and subsequent light responses in plants. The FRS (FAR1 Related Sequences) family of proteins share a similar domain structure to mutator-like transposases, including an N-terminal C2H2 zinc finger domain, a central putative core transposase domain, and a C-terminal SWIM motif (named after SWI2/SNF and MuDR transposases). It seems plausible that the FRS family represent transcription factors derived from mutator-like transposases [, ].   This entry represents a domain found in FAR1 and FRS proteins. It contains a WRKY like fold and is therefore most likely a zinc binding DNA-binding domain.
Probab=99.94  E-value=1.6e-27  Score=181.66  Aligned_cols=89  Identities=40%  Similarity=0.768  Sum_probs=80.5

Q ss_pred             HHHHHHhhhcCeeEEEeeeeeecCCCCeEeeeeeeccCCccCCCcch--hhhccCcccccCCccEEEEEeecCceEEEEE
Q 025532           86 AFYNAYATRVGFVIRVSKLSRSRRDGSAIGRALVCNKEGYRLPDKRE--KIVRQRAETRVGCRAMILVRKVNSGQWVVTK  163 (251)
Q Consensus        86 ~FYn~YA~~~GF~iR~~~~~rs~~dG~i~~r~fvCsreG~r~~~k~~--~~~r~R~~tRtGC~A~i~vk~~~~gkW~V~~  163 (251)
                      +||+.||+.+||+||+.++++++.+|.+++..|+|+++|+...++..  ...++++++||||||+|.|++..+|+|.|+.
T Consensus         1 ~fy~~yA~~~GF~vr~~~s~~~~~~~~~~~~~~~C~r~G~~~~~~~~~~~~~r~~~s~ktgC~a~i~v~~~~~~~w~v~~   80 (91)
T PF03101_consen    1 DFYNSYARRHGFSVRKSSSRKSKKNGEIKRVTFVCSRGGKYKSKKKNEEKRRRNRPSKKTGCKARINVKRRKDGKWRVTS   80 (91)
T ss_pred             CHHHHhcCcCCeEEEEeeeEeCCCCceEEEEEEEECCcccccccccccccccccccccccCCCEEEEEEEccCCEEEEEE
Confidence            59999999999999999998888899999999999999998765433  3567889999999999999987799999999


Q ss_pred             ecccCCCCCCC
Q 025532          164 FVKEHTHPLTP  174 (251)
Q Consensus       164 f~~eHNH~L~p  174 (251)
                      |.++|||||+|
T Consensus        81 ~~~~HNH~L~P   91 (91)
T PF03101_consen   81 FVLEHNHPLCP   91 (91)
T ss_pred             CcCCcCCCCCC
Confidence            99999999997


No 3  
>PF08731 AFT:  Transcription factor AFT;  InterPro: IPR014842 AFT (activator of iron transcription) is an iron regulated transcriptional activator that regulates the expression of genes involved in iron homeostasis. This entry includes the paralogous pair of transcription factors AFT1 and AFT2. 
Probab=98.70  E-value=1.2e-07  Score=76.07  Aligned_cols=88  Identities=17%  Similarity=0.327  Sum_probs=66.6

Q ss_pred             cCCHHHHHHHHHHHhhhcCeeEEEeeeeeecCCCCeEeeeeeeccCCccCCCcch---------------------hhhc
Q 025532           78 FESEAAAHAFYNAYATRVGFVIRVSKLSRSRRDGSAIGRALVCNKEGYRLPDKRE---------------------KIVR  136 (251)
Q Consensus        78 F~S~eeA~~FYn~YA~~~GF~iR~~~~~rs~~dG~i~~r~fvCsreG~r~~~k~~---------------------~~~r  136 (251)
                      |.+.+|...|....++..||.|.+.+|..+       ...|.|--.|.....+..                     ....
T Consensus         1 F~~k~~ikpwlq~~~~~~Gi~iVIerSd~~-------ki~FkCk~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~   73 (111)
T PF08731_consen    1 FDDKDEIKPWLQKIFYPQGIGIVIERSDKK-------KIVFKCKNGKRYRHKKKKKGQAQAQQKESTSGNKNKSSKKKKK   73 (111)
T ss_pred             CCchHHHHHHHHHHhhhcCceEEEEecCCc-------eEEEEEecCCCcccccccccccccccccccccccccccccccC
Confidence            889999999999999999999999876432       257889776654322110                     0011


Q ss_pred             cC-cccccCCccEEEEEee-cCceEEEEEecccCCCCC
Q 025532          137 QR-AETRVGCRAMILVRKV-NSGQWVVTKFVKEHTHPL  172 (251)
Q Consensus       137 ~R-~~tRtGC~A~i~vk~~-~~gkW~V~~f~~eHNH~L  172 (251)
                      ++ .+..++||++|+.... ...+|.|.-+...|||||
T Consensus        74 k~t~srk~~CPFriRA~yS~k~k~W~lvvvnn~HnH~l  111 (111)
T PF08731_consen   74 KRTKSRKNTCPFRIRANYSKKNKKWTLVVVNNEHNHPL  111 (111)
T ss_pred             CcccccccCCCeEEEEEEEecCCeEEEEEecCCcCCCC
Confidence            22 4567899999998763 678999999999999998


No 4  
>PF03108 DBD_Tnp_Mut:  MuDR family transposase;  InterPro: IPR004332 The plant MuDR transposase domain is present in plant proteins that are presumed to be the transposases for Mutator transposable elements [, ]. The function of these proteins is unknown. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=97.88  E-value=6.8e-05  Score=54.25  Aligned_cols=63  Identities=25%  Similarity=0.372  Sum_probs=51.1

Q ss_pred             CccCCccCCHHHHHHHHHHHhhhcCeeEEEeeeeeecCCCCeEeeeeeeccCCccCCCcchhhhccCcccccCCccEEEE
Q 025532           72 PYVGQQFESEAAAHAFYNAYATRVGFVIRVSKLSRSRRDGSAIGRALVCNKEGYRLPDKREKIVRQRAETRVGCRAMILV  151 (251)
Q Consensus        72 P~vGM~F~S~eeA~~FYn~YA~~~GF~iR~~~~~rs~~dG~i~~r~fvCsreG~r~~~k~~~~~r~R~~tRtGC~A~i~v  151 (251)
                      -.+||.|+|.++++.....||-..||.+++.++.+       .+..++|.  +                  .|||++|+.
T Consensus         4 l~~G~~F~~~~e~k~av~~yai~~~~~~~v~ksd~-------~r~~~~C~--~------------------~~C~Wrv~a   56 (67)
T PF03108_consen    4 LEVGQTFPSKEEFKEAVREYAIKNGFEFKVKKSDK-------KRYRAKCK--D------------------KGCPWRVRA   56 (67)
T ss_pred             cccCCEECCHHHHHHHHHHHHHhcCcEEEEeccCC-------EEEEEEEc--C------------------CCCCEEEEE
Confidence            36899999999999999999999999999876532       25678885  1                  179999999


Q ss_pred             Eee-cCceEEE
Q 025532          152 RKV-NSGQWVV  161 (251)
Q Consensus       152 k~~-~~gkW~V  161 (251)
                      ... .++.|.|
T Consensus        57 s~~~~~~~~~I   67 (67)
T PF03108_consen   57 SKRKRSDTFQI   67 (67)
T ss_pred             EEcCCCCEEEC
Confidence            865 4578875


No 5  
>PF04500 FLYWCH:  FLYWCH zinc finger domain;  InterPro: IPR007588 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  C2H2-type (classical) zinc fingers (Znf) were the first class to be characterised. They contain a short beta hairpin and an alpha helix (beta/beta/alpha structure), where a single zinc atom is held in place by Cys(2)His(2) (C2H2) residues in a tetrahedral array. C2H2 Znf's can be divided into three groups based on the number and pattern of fingers: triple-C2H2 (binds single ligand), multiple-adjacent-C2H2 (binds multiple ligands), and separated paired-C2H2 []. C2H2 Znf's are the most common DNA-binding motifs found in eukaryotic transcription factors, and have also been identified in prokaryotes []. Transcription factors usually contain several Znf's (each with a conserved beta/beta/alpha structure) capable of making multiple contacts along the DNA, where the C2H2 Znf motifs recognise DNA sequences by binding to the major groove of DNA via a short alpha-helix in the Znf, the Znf spanning 3-4 bases of the DNA []. C2H2 Znf's can also bind to RNA and protein targets []. This entry represents a potential FLYWCH Zn-finger domain found in a number of eukaryotic proteins. FLYWCH is a C2H2-type zinc finger characterised by five conserved hydrophobic residues, containing the conserved sequence motif:  F/Y-X(n)-L-X(n)-F/Y-X(n)-WXCX(6-12)CX(17-22)HXH  where X indicates any amino acid. This domain was first characterised in Drosophila Modifier of mdg4 proteins, Mod(mgd4), putative chromatin modulators involved in higher order chromatin domains. Mod(mdg4) proteins share a common N-terminal BTB/POZ domain, but differ in their C-terminal region, most containing C-terminal FLYWCH zinc finger motifs []. The FLYWCH domain in Mod(mdg4) proteins has a putative role in protein-protein interactions; for example, Mod(mdg4)-67.2 interacts with DNA-binding protein Su(Hw) via its FLYWCH domain. FLYWCH domains have been described in other proteins as well, including suppressor of killer of prune, Su(Kpn), which contains 4 terminal FLYWCH zinc finger motifs in a tandem array and a C-terminal glutathione SH-transferase (GST) domain []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; PDB: 2RPR_A.
Probab=88.54  E-value=1  Score=30.82  Aligned_cols=25  Identities=36%  Similarity=0.615  Sum_probs=10.0

Q ss_pred             cCCccEEEEEeecCceEEEEEecccCCC
Q 025532          143 VGCRAMILVRKVNSGQWVVTKFVKEHTH  170 (251)
Q Consensus       143 tGC~A~i~vk~~~~gkW~V~~f~~eHNH  170 (251)
                      .+|+|+|.+.   ++.-.|.....+|||
T Consensus        38 ~~C~a~~~~~---~~~~~~~~~~~~HnH   62 (62)
T PF04500_consen   38 HGCRARLITD---AGDGRVVRTNGEHNH   62 (62)
T ss_dssp             S----EEEEE-----TTEEEE-S---SS
T ss_pred             CCCeEEEEEE---CCCCEEEECCCccCC
Confidence            5999999986   233344445589999


No 6  
>PF03106 WRKY:  WRKY DNA -binding domain;  InterPro: IPR003657 The WRKY domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger- like motif. The WRKY domain is found in one or two copies in a superfamily of plant transcription factors involved in the regulation of various physiological programs that are unique to plants, including pathogen defence, senescence, trichome development and the biosynthesis of secondary metabolites. The WRKY domain binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core of the W box is essential for function and WRKY binding []. Some proteins known to contain a WRKY domain include Arabidopsis thaliana ZAP1 (Zinc-dependent Activator Protein-1) and AtWRKY44/TTG2, a protein involved in trichome development and anthocyanin pigmentation; and wild oat ABF1-2, two proteins involved in the gibberelic acid-induced expression of the alpha-Amy2 gene. Structural studies indicate that this domain is a four-stranded beta-sheet with a zinc binding pocket, forming a novel zinc and DNA binding structure []. The WRKYGQK residues correspond to the most N-terminal beta-strand, which enables extensive hydrophobic interactions, contributing to the structural stability of the beta-sheet.; GO: 0003700 sequence-specific DNA binding transcription factor activity, 0043565 sequence-specific DNA binding, 0006355 regulation of transcription, DNA-dependent; PDB: 2AYD_A 1WJ2_A 2LEX_A.
Probab=84.35  E-value=1.4  Score=31.68  Aligned_cols=28  Identities=32%  Similarity=0.637  Sum_probs=21.0

Q ss_pred             CCccEEEEEee-cCceEEEEEecccCCCC
Q 025532          144 GCRAMILVRKV-NSGQWVVTKFVKEHTHP  171 (251)
Q Consensus       144 GC~A~i~vk~~-~~gkW~V~~f~~eHNH~  171 (251)
                      ||+|+=.|... .++.-+++....+||||
T Consensus        31 ~C~akK~Vqr~~~d~~~~~vtY~G~H~h~   59 (60)
T PF03106_consen   31 GCPAKKQVQRSADDPNIVIVTYEGEHNHP   59 (60)
T ss_dssp             TEEEEEEEEEETTCCCEEEEEEES--SS-
T ss_pred             ChhheeeEEEecCCCCEEEEEEeeeeCCC
Confidence            89999888764 46778888899999997


No 7  
>COG5470 Uncharacterized conserved protein [Function unknown]
Probab=59.04  E-value=4.9  Score=31.73  Aligned_cols=30  Identities=30%  Similarity=0.268  Sum_probs=22.5

Q ss_pred             CCccCCccCCHHHHHHHHHHHhhhcCeeEE
Q 025532           71 EPYVGQQFESEAAAHAFYNAYATRVGFVIR  100 (251)
Q Consensus        71 ~P~vGM~F~S~eeA~~FYn~YA~~~GF~iR  100 (251)
                      .+.+=++|+|++.|++|||.=+...=-++|
T Consensus        53 tr~vviEFps~~~ar~~y~SpeYq~a~~~R   82 (96)
T COG5470          53 TRNVVIEFPSLEAARDCYNSPEYQAAAAIR   82 (96)
T ss_pred             ccEEEEEcCCHHHHHHHhcCHHHHHHHHHH
Confidence            456779999999999999975554444444


No 8  
>smart00774 WRKY DNA binding domain. The WRKY domain is a DNA binding domain found in one or two copies in a superfamily of plant transcription factors. These transcription factors are involved in the regulation of various physiological programs that are unique to plants, including pathogen defense, senescence and trichome development. The domain is a 60 amino acid region that is defined by the conserved amino acid sequence WRKYGQK at its N-terminal end, together with a novel zinc-finger-like motif. It binds specifically to the DNA sequence motif (T)(T)TGAC(C/T), which is known as the W box. The invariant TGAC core is essential for function and WRKY binding.
Probab=57.91  E-value=12  Score=26.91  Aligned_cols=28  Identities=32%  Similarity=0.478  Sum_probs=22.0

Q ss_pred             cCCccEEEEEee-cCceEEEEEecccCCC
Q 025532          143 VGCRAMILVRKV-NSGQWVVTKFVKEHTH  170 (251)
Q Consensus       143 tGC~A~i~vk~~-~~gkW~V~~f~~eHNH  170 (251)
                      .||+|+=.|... .++.-.++-...+|||
T Consensus        31 ~~C~a~K~Vq~~~~d~~~~~vtY~g~H~h   59 (59)
T smart00774       31 QGCPAKKQVQRSDDDPSVVEVTYEGEHTH   59 (59)
T ss_pred             CCCCCcccEEEECCCCCEEEEEEeeEeCC
Confidence            489998777654 4677778888999998


No 9  
>PF04684 BAF1_ABF1:  BAF1 / ABF1 chromatin reorganising factor;  InterPro: IPR006774 ABF1 is a sequence-specific DNA binding protein involved in transcription activation, gene silencing and initiation of DNA replication. ABF1 is known to remodel chromatin, and it is proposed that it mediates its effects on transcription and gene expression by modifying local chromatin architecture []. These functions require a conserved stretch of 20 amino acids in the C-terminal region of ABF1 (amino acids 639 to 662 Saccharomyces cerevisiae (P14164 from SWISSPROT)) []. The N-terminal two thirds of the protein are necessary for DNA binding, and the N terminus (amino acids 9 to 91 in S. cerevisiae) is thought to contain a novel zinc-finger motif which may stabilise the protein structure [].; GO: 0003677 DNA binding, 0006338 chromatin remodeling, 0005634 nucleus
Probab=57.86  E-value=4.9  Score=39.91  Aligned_cols=42  Identities=17%  Similarity=0.235  Sum_probs=31.6

Q ss_pred             CCccCCHHHHHHHHHHHhhhcCeeEEEeeeeeecCCCCeEeeeeeecc
Q 025532           75 GQQFESEAAAHAFYNAYATRVGFVIRVSKLSRSRRDGSAIGRALVCNK  122 (251)
Q Consensus        75 GM~F~S~eeA~~FYn~YA~~~GF~iR~~~~~rs~~dG~i~~r~fvCsr  122 (251)
                      +..|+|+++=|.-.|.|-...---|....+.|.+      -.+|.|..
T Consensus        25 ~~~f~tl~~wy~v~ndyefq~rcpiilknsh~nk------hftfachl   66 (496)
T PF04684_consen   25 ARKFPTLEAWYNVINDYEFQSRCPIILKNSHRNK------HFTFACHL   66 (496)
T ss_pred             ccCCCcHHHHHHHHhhhhhhhcCceeeccccccc------ceEEEeec
Confidence            6789999999999999998777777655554432      35677765


No 10 
>smart00461 WH1 WASP homology region 1. Region of the Wiskott-Aldrich syndrome protein (WASp) that contains point mutations in the majority of patients with WAS. Unknown function. Ena-like WH1 domains bind polyproline-containing peptides, and that Homer contains a WH1 domain.
Probab=55.67  E-value=7.3  Score=30.71  Aligned_cols=23  Identities=30%  Similarity=0.364  Sum_probs=19.2

Q ss_pred             CCCccCCccCCHHHHHHHHHHHh
Q 025532           70 DEPYVGQQFESEAAAHAFYNAYA   92 (251)
Q Consensus        70 ~~P~vGM~F~S~eeA~~FYn~YA   92 (251)
                      ..=.+|..|.|++||..|++.-.
T Consensus        81 ~~~~~GLnF~se~EA~~F~~~v~  103 (106)
T smart00461       81 DKCVYGLNFASEEEAKKFRKKVL  103 (106)
T ss_pred             CCeEEEeecCCHHHHHHHHHHHH
Confidence            34468999999999999998654


No 11 
>PF07576 BRAP2:  BRCA1-associated protein 2;  InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening []. These proteins share a region of sequence similarity at their N terminus. They also have IPR001607 from INTERPRO at the C terminus.
Probab=53.94  E-value=8.8  Score=30.81  Aligned_cols=21  Identities=24%  Similarity=0.498  Sum_probs=18.1

Q ss_pred             ccCCccCCHHHHHHHHHHHhh
Q 025532           73 YVGQQFESEAAAHAFYNAYAT   93 (251)
Q Consensus        73 ~vGM~F~S~eeA~~FYn~YA~   93 (251)
                      .+=|.|.+.+.|.+||..|-.
T Consensus        56 mVLikF~~~~~Ad~Fy~~fNG   76 (110)
T PF07576_consen   56 MVLIKFRDQESADEFYEEFNG   76 (110)
T ss_pred             EEEEEECCHHHHHHHHHHhCC
Confidence            456799999999999999954


No 12 
>cd00837 EVH1 EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. EVH1 (Enabled, Vasp-Homology) or WASP Homology (WH1) domain. The EVH1 domain binds to other proteins at proline rich sequences in either FPPPP or PPXXF motifs. It is found in the cytoskeletal reorganization proteins Enabled VASP, and WASP, and in the synaptic scaffolding protein Homer. It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=52.85  E-value=8.3  Score=30.20  Aligned_cols=21  Identities=29%  Similarity=0.319  Sum_probs=18.2

Q ss_pred             CCccCCccCCHHHHHHHHHHH
Q 025532           71 EPYVGQQFESEAAAHAFYNAY   91 (251)
Q Consensus        71 ~P~vGM~F~S~eeA~~FYn~Y   91 (251)
                      .=.+|..|.|++||..|++.-
T Consensus        80 ~~~~GL~F~se~eA~~F~~~v  100 (104)
T cd00837          80 NCVYGLNFASEEEAAQFRKKV  100 (104)
T ss_pred             CcEEEEeeCCHHHHHHHHHHH
Confidence            346899999999999999864


No 13 
>cd01205 WASP WASP-type EVH1 domain. WASP-type EVH1 domain.  Wiskott-Aldrich syndrome (WAS) is an X-linked recessive disease, characterized by eczema, immunodeficiency, and thrombocytopenia. The majority of patients with WAS, or a milder version of the disorder,  X-linked thrombocytopenia (XLT), have point mutations in the EVH1 domain of WASP (Wiskott-Aldrich syndrome protein).  WASP  is an actin regulatory protein consisting of an N-terminal EVH1 domain, a basic region, a GTP binding domain, a proline rich region and a WH2 acidic region.  Yeast members lack the GTP binding domain. WASP binds a 25 residue proline rich motif from the WASP Interacting Protein (WIP) via its N-terminal EVH1 domain.
Probab=49.21  E-value=10  Score=30.41  Aligned_cols=25  Identities=28%  Similarity=0.416  Sum_probs=20.4

Q ss_pred             CCCCCccCCccCCHHHHHHHHHHHh
Q 025532           68 QADEPYVGQQFESEAAAHAFYNAYA   92 (251)
Q Consensus        68 ~~~~P~vGM~F~S~eeA~~FYn~YA   92 (251)
                      +..+=.+|..|.+++||..||+.-.
T Consensus        78 e~d~c~~GL~Fade~EA~~F~k~v~  102 (105)
T cd01205          78 EGDDCVVGLNFADETEAAEFRKKVL  102 (105)
T ss_pred             eccCcEEEEEECCHHHHHHHHHHHH
Confidence            3446678999999999999998643


No 14 
>PF02185 HR1:  Hr1 repeat;  InterPro: IPR000861 The HR1 repeat was first described as a three times repeated homology region of the N-terminal non-catalytic part of protein kinase PRK1(PKN) []. The first two of these repeats were later shown to bind the small G protein rho [, ] known to activate PKN in its GTP-bound form. Similar rho-binding domains also occur in a number of other protein kinases and in the rho-binding proteins rhophilin and rhotekin. Recently, the structure of the N-terminal HR1 repeat complexed with RhoA has been determined by X-ray crystallography []. It forms an antiparallel coiled-coil fold termed an ACC finger. This entry includes domains found within rho-associated protein kinases.; GO: 0007165 signal transduction, 0005622 intracellular; PDB: 1CXZ_B 3O0Z_C 2RMK_B 1URF_A.
Probab=48.10  E-value=1e+02  Score=22.14  Aligned_cols=57  Identities=18%  Similarity=0.294  Sum_probs=43.9

Q ss_pred             hHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHhhHHHHHHHHHHHHHHHHhhhhhcc
Q 025532          192 KIRELSQQLALEKKRAANYKRHLELI-------VEQIEEHNESLAKKIQHVVDSVKNIEDEEQK  248 (251)
Q Consensus       192 ~I~el~~el~~~~k~~~~~r~~l~~~-------~k~v~eh~~~ls~~i~~iv~~~k~~E~e~~~  248 (251)
                      .|.+|..+|.+|.++-.+...++..+       ...+......-..+|..+-..+++++...+.
T Consensus         2 ~i~~L~~~i~~E~ki~~Gae~m~~~~~t~~~~~~~~~~~~l~~s~~kI~~L~~~L~~l~~~~~~   65 (70)
T PF02185_consen    2 RIEELQKKIDKELKIKEGAENMLQAYSTDKKKVLSEAESQLRESNQKIELLREQLEKLQQRSQN   65 (70)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHCCHHCH-HHHHHHHHHHHHHHHHHHHHHHHHHHCCHH-
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHccCcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhCcC
Confidence            47788899999999888877776642       4455566677788999999999999887654


No 15 
>PF00568 WH1:  WH1 domain;  InterPro: IPR000697 The EVH1 (WH1, RanBP1-WASP) domain is found in multi-domain proteins implicated in a diverse range of signalling, nuclear transport and cytoskeletal events. This domain of around 115 amino acids is present in species ranging from yeast to mammals. Many EVH1-containing proteins associate with actin-based structures and play a role in cytoskeletal organisation. EVH1 domains recognise and bind the proline-rich motif FPPPP with low-affinity, further interactions then form between flanking residues [][].  WASP family proteins contain a EVH1 (WH1) in their N-terminals which bind proline-rich sequences in the WASP interacting protein. Proteins of the RanBP1 family contain a WH1 domain in their N-terminal region, which seems to bind a different sequence motif present in the C-terminal part of RanGTP protein [,].  Tertiary structure of the WH1 domain of the Mena protein revealed structure similarities with the pleckstrin homology (PH) domain. The overall fold consists of a compact parallel beta-sandwich, closed along one edge by a long alpha-helix. A highly conserved cluster of three surface-exposed aromatic side-chains forms the recognition site for the molecules target ligands. [].; GO: 0005515 protein binding; PDB: 1I2H_A 1DDV_A 1DDW_A 1EGX_A 3SYX_A 1TJ6_B 1XOD_B 1EVH_A 1I7A_B 2JP2_A ....
Probab=48.06  E-value=11  Score=29.81  Aligned_cols=20  Identities=35%  Similarity=0.547  Sum_probs=18.0

Q ss_pred             ccCCccCCHHHHHHHHHHHh
Q 025532           73 YVGQQFESEAAAHAFYNAYA   92 (251)
Q Consensus        73 ~vGM~F~S~eeA~~FYn~YA   92 (251)
                      .+|+.|.|++||..||+.--
T Consensus        89 ~~GLnF~se~eA~~F~~~v~  108 (111)
T PF00568_consen   89 VYGLNFASEEEADQFYKKVQ  108 (111)
T ss_dssp             EEEEEESSHHHHHHHHHHHH
T ss_pred             EEEEecCCHHHHHHHHHHHh
Confidence            78999999999999998753


No 16 
>PF04684 BAF1_ABF1:  BAF1 / ABF1 chromatin reorganising factor;  InterPro: IPR006774 ABF1 is a sequence-specific DNA binding protein involved in transcription activation, gene silencing and initiation of DNA replication. ABF1 is known to remodel chromatin, and it is proposed that it mediates its effects on transcription and gene expression by modifying local chromatin architecture []. These functions require a conserved stretch of 20 amino acids in the C-terminal region of ABF1 (amino acids 639 to 662 Saccharomyces cerevisiae (P14164 from SWISSPROT)) []. The N-terminal two thirds of the protein are necessary for DNA binding, and the N terminus (amino acids 9 to 91 in S. cerevisiae) is thought to contain a novel zinc-finger motif which may stabilise the protein structure [].; GO: 0003677 DNA binding, 0006338 chromatin remodeling, 0005634 nucleus
Probab=45.33  E-value=46  Score=33.29  Aligned_cols=27  Identities=30%  Similarity=0.412  Sum_probs=18.9

Q ss_pred             EEEEecccCCCCCCCCCCCcccccccC
Q 025532          160 VVTKFVKEHTHPLTPGKGRKDCIYDQY  186 (251)
Q Consensus       160 ~V~~f~~eHNH~L~p~~~~~~~~~~~~  186 (251)
                      +|++++.-|||||...-++..|++..+
T Consensus       168 ~v~k~~~~h~h~l~~nl~l~~fvltki  194 (496)
T PF04684_consen  168 VVTKIEPYHNHPLESNLSLDKFVLTKI  194 (496)
T ss_pred             EEEeeccccCCcccccccHHHHHHhcc
Confidence            377888889999876666666664433


No 17 
>PF04800 ETC_C1_NDUFA4:  ETC complex I subunit conserved region;  InterPro: IPR006885 This entry represents prokaryotic NADH-ubiquinone oxidoreductase subunits (1.6.5.3 from EC, 1.6.99.3 from EC) from complex I of the electron transport chain initially identified in Neurospora crassa as a 21 kDa protein [].; GO: 0016651 oxidoreductase activity, acting on NADH or NADPH, 0022900 electron transport chain, 0005743 mitochondrial inner membrane; PDB: 2JYA_A 2LJU_A.
Probab=44.33  E-value=18  Score=28.76  Aligned_cols=26  Identities=38%  Similarity=0.540  Sum_probs=20.0

Q ss_pred             cCCccCCHHHHHHHHHHHhhhcCeeEEEee
Q 025532           74 VGQQFESEAAAHAFYNAYATRVGFVIRVSK  103 (251)
Q Consensus        74 vGM~F~S~eeA~~FYn~YA~~~GF~iR~~~  103 (251)
                      +-|.|+|.|+|..    ||.+.|..-.+..
T Consensus        51 v~l~F~skE~Ai~----yaer~G~~Y~V~~   76 (101)
T PF04800_consen   51 VRLKFDSKEDAIA----YAERNGWDYEVEE   76 (101)
T ss_dssp             CEEEESSHHHHHH----HHHHCT-EEEEE-
T ss_pred             eEeeeCCHHHHHH----HHHHcCCeEEEeC
Confidence            5789999999975    6888998877654


No 18 
>PF07045 DUF1330:  Protein of unknown function (DUF1330);  InterPro: IPR010753 This family consists of several hypothetical bacterial proteins of around 90 residues in length. The function of this family is unknown.; PDB: 2FIU_B 3HHL_A 3DCA_D 3LO3_I.
Probab=41.18  E-value=13  Score=26.47  Aligned_cols=17  Identities=47%  Similarity=0.579  Sum_probs=14.6

Q ss_pred             cCCccCCHHHHHHHHHH
Q 025532           74 VGQQFESEAAAHAFYNA   90 (251)
Q Consensus        74 vGM~F~S~eeA~~FYn~   90 (251)
                      +=.+|+|.++|..||+.
T Consensus        42 viieFPs~~aa~~~~~s   58 (65)
T PF07045_consen   42 VIIEFPSMEAAKAWYNS   58 (65)
T ss_dssp             EEEEESSHHHHHHHHCS
T ss_pred             EEEECCCHHHHHHHHCC
Confidence            34699999999999985


No 19 
>PF15299 ALS2CR8:  Amyotrophic lateral sclerosis 2 chromosomal region candidate gene 8
Probab=33.95  E-value=57  Score=29.04  Aligned_cols=17  Identities=24%  Similarity=0.591  Sum_probs=14.5

Q ss_pred             ccCcccccCCccEEEEE
Q 025532          136 RQRAETRVGCRAMILVR  152 (251)
Q Consensus       136 r~R~~tRtGC~A~i~vk  152 (251)
                      +...+.+.+|||.|.|+
T Consensus        71 ~~~~skK~~CPA~I~Ik   87 (225)
T PF15299_consen   71 RSKPSKKRDCPARIYIK   87 (225)
T ss_pred             ccccccCCCCCeEEEEE
Confidence            45678899999999987


No 20 
>PF05377 FlaC_arch:  Flagella accessory protein C (FlaC);  InterPro: IPR008039 Although archaeal flagella appear superficially similar to those of bacteria, they are quite distinct []. In several archaea, the flagellin genes are followed immediately by the flagellar accessory genes flaCDEFGHIJ. The gene products may have a role in translocation, secretion, or assembly of the flagellum. FlaC is a protein whose exact role is unknown but it has been shown to be membrane-associated (by immuno-blotting fractionated cells) [].
Probab=31.89  E-value=1.5e+02  Score=21.20  Aligned_cols=29  Identities=17%  Similarity=0.541  Sum_probs=21.5

Q ss_pred             HHHHHHHHHHhhHHHHHHHHHHHHHHHHh
Q 025532          214 LELIVEQIEEHNESLAKKIQHVVDSVKNI  242 (251)
Q Consensus       214 l~~~~k~v~eh~~~ls~~i~~iv~~~k~~  242 (251)
                      +.+.+..++..++.++..++.+=++||++
T Consensus        12 ~~~~i~tvk~en~~i~~~ve~i~envk~l   40 (55)
T PF05377_consen   12 IESSINTVKKENEEISESVEKIEENVKDL   40 (55)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            45556677778888888888888877765


No 21 
>cd01207 Ena-Vasp Enabled-VASP-type homology (EVH1) domain. Enabled-VASP-type homology (EVH1) domain. The EVH1 domain binds to other proteins at proline rich sequences. It is found in proteins involved in cytoskeletal reorganization such as Enabled and VASP. Ena-VASP type EVH1 domains specifically recognize FPPPP motifs in the focal adhesion proteins zyxin and vinculin, and the ActA surface protein of Listeria monocytogenes.  It has a PH-like fold, despite having minimal sequence similarity to PH or PTB domains.
Probab=31.10  E-value=33  Score=27.70  Aligned_cols=21  Identities=29%  Similarity=0.355  Sum_probs=17.9

Q ss_pred             CCccCCccCCHHHHHHHHHHH
Q 025532           71 EPYVGQQFESEAAAHAFYNAY   91 (251)
Q Consensus        71 ~P~vGM~F~S~eeA~~FYn~Y   91 (251)
                      .=..|..|.|++||..|+..-
T Consensus        83 ~~v~GLnF~Se~eA~~F~~~v  103 (111)
T cd01207          83 RQVYGLNFGSKEDATMFASAM  103 (111)
T ss_pred             CeEEeeccCCHHHHHHHHHHH
Confidence            346799999999999998764


No 22 
>PHA02047 phage lambda Rz1-like protein
Probab=30.49  E-value=2.6e+02  Score=22.31  Aligned_cols=47  Identities=17%  Similarity=0.371  Sum_probs=34.9

Q ss_pred             CchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHH
Q 025532          188 NEHDKIRELSQQLALEKKRAANYKRHLELIVEQIEEHNESLAKKIQHVVDS  238 (251)
Q Consensus       188 ~shk~I~el~~el~~~~k~~~~~r~~l~~~~k~v~eh~~~ls~~i~~iv~~  238 (251)
                      -.|+.+..+..+|...+.+-..|+++..-    ++...+....+|.+.++.
T Consensus        31 ~~h~~a~~la~qLE~a~~r~~~~Q~~V~~----l~~kae~~t~Ei~~aL~~   77 (101)
T PHA02047         31 IAHEEAKRQTARLEALEVRYATLQRHVQA----VEARTNTQRQEVDRALDQ   77 (101)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHh
Confidence            35889999999999988888888888643    444456666677766663


No 23 
>PF08414 NADPH_Ox:  Respiratory burst NADPH oxidase;  InterPro: IPR013623 This domain is found in plant proteins such as respiratory burst NADPH oxidase proteins which produce reactive oxygen species as a defence mechanism. It tends to occur to the N terminus of an EF-hand (IPR002048 from INTERPRO), which suggests a direct regulatory effect of Ca2+ on the activity of the NADPH oxidase in plants []. ; GO: 0004601 peroxidase activity, 0050664 oxidoreductase activity, acting on NADH or NADPH, oxygen as acceptor, 0055114 oxidation-reduction process; PDB: 3A8R_A.
Probab=29.08  E-value=41  Score=26.79  Aligned_cols=26  Identities=27%  Similarity=0.469  Sum_probs=19.2

Q ss_pred             CccCCccCCHHHHHHHHHHHhhhcCee
Q 025532           72 PYVGQQFESEAAAHAFYNAYATRVGFV   98 (251)
Q Consensus        72 P~vGM~F~S~eeA~~FYn~YA~~~GF~   98 (251)
                      -+|||. +|.|=|-+-|.+-|++.|-.
T Consensus        52 ~CIGM~-dSkeFA~eLFdALaRrr~i~   77 (100)
T PF08414_consen   52 ECIGMK-DSKEFAGELFDALARRRGIK   77 (100)
T ss_dssp             HHHT---S-HHHHHHHHHHHHHHTT--
T ss_pred             HhcCCc-ccHHHHHHHHHHHHHhcCCc
Confidence            479999 99999999999999987654


No 24 
>PF06295 DUF1043:  Protein of unknown function (DUF1043);  InterPro: IPR009386 This entry consists of several hypothetical bacterial proteins of unknown function.
Probab=26.20  E-value=3.5e+02  Score=21.88  Aligned_cols=33  Identities=24%  Similarity=0.341  Sum_probs=23.6

Q ss_pred             CchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q 025532          188 NEHDKIRELSQQLALEKKRAANYKRHLELIVEQ  220 (251)
Q Consensus       188 ~shk~I~el~~el~~~~k~~~~~r~~l~~~~k~  220 (251)
                      ++-++...|.++|...+.....|++.+..-|..
T Consensus        22 ~~~~~q~~l~~eL~~~k~el~~yk~~V~~HF~~   54 (128)
T PF06295_consen   22 SNQQKQAKLEQELEQAKQELEQYKQEVNDHFAQ   54 (128)
T ss_pred             cchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            444567788888888888888888877654433


No 25 
>PF12441 DUF3680:  Protein of unknown function (DUF3680) ;  InterPro: IPR022148  This domain family is found in bacteria and archaea, and is approximately 40 amino acids in length. 
Probab=24.94  E-value=59  Score=21.83  Aligned_cols=14  Identities=29%  Similarity=0.719  Sum_probs=13.1

Q ss_pred             ccCCHHHHHHHHHH
Q 025532           77 QFESEAAAHAFYNA   90 (251)
Q Consensus        77 ~F~S~eeA~~FYn~   90 (251)
                      .|.|+++|.+|+..
T Consensus         7 ~f~se~Ee~eFW~~   20 (42)
T PF12441_consen    7 EFKSEEEEREFWDT   20 (42)
T ss_pred             CCCCHHHHHHHHHh
Confidence            79999999999987


No 26 
>PF01693 Cauli_VI:  Caulimovirus viroplasmin;  InterPro: IPR011320 This entry represents the N-terminal domain of RNase HI, which has a 3-layer alpha/beta/alpha structure []. This domain is lacking in retroviral and prokaryotic enzymes, but shows a striking structural similarity to the ribosomal protein L9 N-terminal domain, and may function as a regulatory RNA-binding module. However, the topology of this domain differs from structures of known RNA binding domains such as the double-stranded RNA binding domain (dsRBD), the hnRNP K homology (KH) domain and the RNP motif. Eukaryotic RNases HI possess either one or two copies of this small N-terminal domain, in addition to the well-conserved catalytic RNase H domain. RNase HI belongs to the family of ribonuclease H enzymes that recognise RNA:DNA hybrids and degrade the RNA component. ; PDB: 1QHK_A 3BSU_C.
Probab=24.54  E-value=45  Score=21.98  Aligned_cols=13  Identities=23%  Similarity=0.452  Sum_probs=11.3

Q ss_pred             CCccCCHHHHHHH
Q 025532           75 GQQFESEAAAHAF   87 (251)
Q Consensus        75 GM~F~S~eeA~~F   87 (251)
                      =+.|.|++||.+|
T Consensus        32 ~k~F~t~~eA~~~   44 (44)
T PF01693_consen   32 YKSFKTREEAEEF   44 (44)
T ss_dssp             EEEESSHHHHHHH
T ss_pred             ECCcCCHHHHhhC
Confidence            4789999999987


No 27 
>PF02024 Leptin:  Leptin;  InterPro: IPR000065 Leptin, a metabolic monitor of food intake and energy need, is expressed by the ob obesity gene. The protein may function as part of a signalling pathway from adipose tissue that acts to regulate the size of the body fat depot [], the hormone effectively turning the brain's appetite message off when it senses that the body is satiated. Obese humans have high levels of the protein, suggesting a similarity to type II (adult onset) diabetes, in which sufferers over-produce insulin, but can't respond to it metabolically - they have become insulin resistant. Similarly, it is thought that obese individuals may be leptin resistant.; GO: 0005179 hormone activity, 0007165 signal transduction, 0005576 extracellular region; PDB: 1AX8_A.
Probab=23.86  E-value=1.2e+02  Score=25.80  Aligned_cols=70  Identities=14%  Similarity=0.244  Sum_probs=32.2

Q ss_pred             cccCCCCC-CCCCCCcccccccCCCchhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhh
Q 025532          165 VKEHTHPL-TPGKGRKDCIYDQYPNEHDKIRELSQQLALEKKRAANYKRHLELIVEQIEEHNESLAKKIQHVVDSVKNIE  243 (251)
Q Consensus       165 ~~eHNH~L-~p~~~~~~~~~~~~~~shk~I~el~~el~~~~k~~~~~r~~l~~~~k~v~eh~~~ls~~i~~iv~~~k~~E  243 (251)
                      +.+|+|.+ ++++.+..- + .|.+..+.|..|    .-...-.++|++.|.+.=.   .|...++.|++++.+++.-+=
T Consensus        21 I~~~~~~~~vssk~~I~g-l-dfiPg~~pi~sL----s~mdqTL~~yQ~IL~sLps---~nv~QIsnDlenLr~lL~~la   91 (146)
T PF02024_consen   21 INDHSHQQSVSSKQRITG-L-DFIPGLQPILSL----SSMDQTLAIYQQILTSLPS---GNVSQISNDLENLRDLLHLLA   91 (146)
T ss_dssp             HHH-------------------S---SS--SSH----HHHHHHHHHHHHHHHTS-----HHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHhcchhccCCccccccC-c-ccCCCcchhccH----HHHHHHHHHHHHHHHhCCh---hhHHHHHHHHHHHHHHHHHHH
Confidence            57899987 344432211 1 123445555543    3345567888888755433   567788889888888887553


No 28 
>PF08471 Ribonuc_red_2_N:  Class II vitamin B12-dependent ribonucleotide reductase;  InterPro: IPR013678 This domain is found to the N terminus of the ribonucleotide reductase barrel domain (IPR000788 from INTERPRO). It occurs in bacterial class II ribonucleotide reductase proteins which depend upon coenzyme B12 (deoxyadenosylcobalamine) []. ; GO: 0004748 ribonucleoside-diphosphate reductase activity, 0050897 cobalt ion binding, 0055114 oxidation-reduction process
Probab=23.61  E-value=66  Score=25.31  Aligned_cols=17  Identities=35%  Similarity=0.608  Sum_probs=14.7

Q ss_pred             ccCCHHHHHHHHHHHhh
Q 025532           77 QFESEAAAHAFYNAYAT   93 (251)
Q Consensus        77 ~F~S~eeA~~FYn~YA~   93 (251)
                      -|+|+++|..||..-+.
T Consensus        72 YF~t~eDA~~FydEl~~   88 (93)
T PF08471_consen   72 YFATEEDAEAFYDELTY   88 (93)
T ss_pred             CcCCHHHHHHHHHHHHH
Confidence            69999999999987553


No 29 
>PF03670 UPF0184:  Uncharacterised protein family (UPF0184);  InterPro: IPR022788  This family of proteins has no known function. 
Probab=21.16  E-value=2.2e+02  Score=21.98  Aligned_cols=34  Identities=24%  Similarity=0.464  Sum_probs=28.6

Q ss_pred             HHHHHHHHHHHHhhHHHHHHHHHHHHHHHHhhhh
Q 025532          212 RHLELIVEQIEEHNESLAKKIQHVVDSVKNIEDE  245 (251)
Q Consensus       212 ~~l~~~~k~v~eh~~~ls~~i~~iv~~~k~~E~e  245 (251)
                      .+|.+.|..|++.+.+|...++.+|+.=|++-.+
T Consensus        36 D~Lns~LD~LE~rnD~l~~~L~~LLesnrq~R~e   69 (83)
T PF03670_consen   36 DQLNSCLDHLEQRNDHLHAQLQELLESNRQIRLE   69 (83)
T ss_pred             HHHHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHH
Confidence            5677778899999999999999999988876544


Done!