BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025544
         (251 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|1N91|A Chain A, Solution Nmr Structure Of Protein Yggu From Escherichia
           Coli. Northeast Structural Genomics Consortium Target
           Er14.
 pdb|1YH5|A Chain A, Solution Nmr Structure Of Protein Yggu From Escherichia
           Coli. Northeast Structural Genomics Consortium Target
           Er14
          Length = 108

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/71 (30%), Positives = 45/71 (63%), Gaps = 1/71 (1%)

Query: 159 EGGLVQVAIEVEDRAQRSAITRVNADDVRVTVAAPAARGEANNELLEFMGKVLSLRLSQM 218
           + GLV + + ++ +A R +I  ++ D+V+V + AP   G+AN+ L++F+GK   +  SQ+
Sbjct: 12  DDGLV-LRLYIQPKASRDSIVGLHGDEVKVAITAPPVDGQANSHLVKFLGKQFRVAKSQV 70

Query: 219 TLQRGWNNKSK 229
            +++G   + K
Sbjct: 71  VIEKGELGRHK 81


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.317    0.131    0.367 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,129,350
Number of Sequences: 62578
Number of extensions: 176332
Number of successful extensions: 513
Number of sequences better than 100.0: 1
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 512
Number of HSP's gapped (non-prelim): 1
length of query: 251
length of database: 14,973,337
effective HSP length: 96
effective length of query: 155
effective length of database: 8,965,849
effective search space: 1389706595
effective search space used: 1389706595
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 50 (23.9 bits)