Citrus Sinensis ID: 025553


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-
MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYGPNAEKIQQGRIVESSSKSKGRSRSRSPRPRYRDEHRDKDYRRRSRSRSRERYDRDRYRSKERDHRRRSRSRSASPDRHKNHGRGKYDEERRSRSRSYESASPPRHSPNSKRSPSPRKTHKGEINPDERSPALKRVSPDGRRSVSRSLSPRRSPANE
ccccccccccccccccEEEEccccccccHHHHHHHHccccccEEEEEcccccccccccEEEEEEccHHHHHHHHHHccccEEcccEEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccccEEEEEccccccccHHHHHHHHHHcccEEEEEEcccccccccccEEEEEEccHHHHHHHHHHccccEEccEEEEEEEcccccccccccccccccccccccccccccccccccccccccccccEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
mshfgksgppdirdTYSLLVLNITFrttaddlfplfekYGKVvdvfiprdrrtgdsrgFAFVRYKYADEAQKAVDrldgrvvdgrEITVQFAkygpnaekiqqgrivessskskgrsrsrsprpryrdehrdkdyrrrsrsrsrerydrdryrskerdhrrrsrsrsaspdrhknhgrgkydeerrsrsrsyesaspprhspnskrspsprkthkgeinpderspalkrvspdgrrsvsrslsprrspane
mshfgksgppdirDTYSLLVLNITFRTTADDLFPLFEKYGKvvdvfiprdrrtgdsrgfafvrykyadeaqkavdrldgrvvDGREITVqfakygpnaekiqqgrivessskskgrsrsrsprpryrdehrdkdyrrrsrsrsrerydrdryrskerdhrrrsrsrsaspdrhknhgrgkydeerrsrsrsyesaspprhspnskrspsprkthkgeinpderspalkrvspdgrrsvsrslsprrspane
MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYGPNAEKIQQGRIVEssskskgrsrsrsprprYRDEHrdkdyrrrsrsrsrerydrdryrskerdhrrrsrsrsaspdrHKNHGRGKYDeerrsrsrsyesaspprhspnskrspsprKTHKGEINPDERSPALKRVSPDGrrsvsrslsprrsPANE
************RDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYG************************************************************************************************************************************************************
************RDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQ*****************************************************************************************************************************************************************
*********PDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYGPNAEKIQQG*******************************************************************************************************************PDERSPAL************************
********P**IRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKY*************************************************************************************************************************************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYGPNAEKIQQGRIVESSSKSKGRSRSRSPRPRYRDEHRDKDYRRRSRSRSRERYDRDRYRSKERDHRRRSRSRSASPDRHKNHGRGKYDEERRSRSRSYESASPPRHSPNSKRSPSPRKTHKGEINPDERSPALKRVSPDGRRSVSRSLSPRRSPANE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query251 2.2.26 [Sep-21-2011]
P30352221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 2e-21
Q5R1W5221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 4e-21
Q06A98221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 2e-20
Q6PDU1221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 3e-20
Q62093221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 3e-20
Q01130221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 3e-20
Q3MHR5221 Serine/arginine-rich spli yes no 0.346 0.393 0.563 3e-20
Q9BRL6282 Serine/arginine-rich spli no no 0.346 0.308 0.505 6e-17
Q09511196 Probable splicing factor, yes no 0.338 0.433 0.482 1e-15
Q9SEU4287 Serine/arginine-rich spli no no 0.306 0.268 0.441 2e-12
>sp|P30352|SRSF2_CHICK Serine/arginine-rich splicing factor 2 OS=Gallus gallus GN=SRSF2 PE=2 SV=1 Back     alignment and function desciption
 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 65/87 (74%)

Query: 9  PPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYAD 68
          PPD+    SL V N+T+RT+ D L  +FEKYG+V DV+IPRDR T +SRGFAFVR+    
Sbjct: 7  PPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR 66

Query: 69 EAQKAVDRLDGRVVDGREITVQFAKYG 95
          +A+ A+D +DG V+DGRE+ VQ A+YG
Sbjct: 67 DAEDAMDAMDGAVLDGRELRVQMARYG 93




Necessary for the splicing of pre-mRNA. It is required for formation of the earliest ATP-dependent splicing complex and interacts with spliceosomal components bound to both the 5'- and 3'-splice sites during spliceosome assembly. It also is required for ATP-dependent interactions of both U1 and U2 snRNPs with pre-mRNA.
Gallus gallus (taxid: 9031)
>sp|Q5R1W5|SRSF2_PANTR Serine/arginine-rich splicing factor 2 OS=Pan troglodytes GN=SRSF2 PE=2 SV=3 Back     alignment and function description
>sp|Q06A98|SRSF2_PIG Serine/arginine-rich splicing factor 2 OS=Sus scrofa GN=SRSF2 PE=2 SV=1 Back     alignment and function description
>sp|Q6PDU1|SRSF2_RAT Serine/arginine-rich splicing factor 2 OS=Rattus norvegicus GN=Srsf2 PE=1 SV=3 Back     alignment and function description
>sp|Q62093|SRSF2_MOUSE Serine/arginine-rich splicing factor 2 OS=Mus musculus GN=Srsf2 PE=1 SV=4 Back     alignment and function description
>sp|Q01130|SRSF2_HUMAN Serine/arginine-rich splicing factor 2 OS=Homo sapiens GN=SRSF2 PE=1 SV=4 Back     alignment and function description
>sp|Q3MHR5|SRSF2_BOVIN Serine/arginine-rich splicing factor 2 OS=Bos taurus GN=SRSF2 PE=2 SV=3 Back     alignment and function description
>sp|Q9BRL6|SRSF8_HUMAN Serine/arginine-rich splicing factor 8 OS=Homo sapiens GN=SRSF8 PE=1 SV=1 Back     alignment and function description
>sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-rich 4 OS=Caenorhabditis elegans GN=rsp-4 PE=3 SV=1 Back     alignment and function description
>sp|Q9SEU4|SR33_ARATH Serine/arginine-rich splicing factor 33 OS=Arabidopsis thaliana GN=SR33 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
255581357257 serine/arginine rich splicing factor, pu 0.996 0.972 0.693 3e-67
225459316257 PREDICTED: uncharacterized protein LOC10 0.972 0.949 0.746 7e-67
78191396258 unknown [Solanum tuberosum] 0.964 0.937 0.683 8e-65
356524836267 PREDICTED: uncharacterized protein LOC10 0.988 0.928 0.629 5e-60
118484490302 unknown [Populus trichocarpa] 0.752 0.625 0.785 3e-59
356512057267 PREDICTED: uncharacterized protein LOC10 0.988 0.928 0.629 6e-58
224066947178 predicted protein [Populus trichocarpa] 0.701 0.988 0.8 8e-58
148909922267 unknown [Picea sitchensis] 0.980 0.921 0.585 3e-57
218200049271 hypothetical protein OsI_26921 [Oryza sa 0.852 0.789 0.652 4e-57
297797433305 hypothetical protein ARALYDRAFT_496619 [ 0.920 0.757 0.657 2e-56
>gi|255581357|ref|XP_002531488.1| serine/arginine rich splicing factor, putative [Ricinus communis] gi|223528897|gb|EEF30895.1| serine/arginine rich splicing factor, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  260 bits (665), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 179/258 (69%), Positives = 209/258 (81%), Gaps = 8/258 (3%)

Query: 1   MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFA 60
           MSHFG+SGPPDI DTYSLLVLNITFRTTADDLFPLF+KYGKVVD+FIPRDRRTGDSRGFA
Sbjct: 1   MSHFGRSGPPDITDTYSLLVLNITFRTTADDLFPLFDKYGKVVDIFIPRDRRTGDSRGFA 60

Query: 61  FVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYGPNAEKIQQGRIVESSSKSKGRSRSR 120
           FVRYKYADEAQKAV+RLDGRVVDGREITVQFAKYGPNAE+I +GRI+E   +S+ RSRSR
Sbjct: 61  FVRYKYADEAQKAVERLDGRVVDGREITVQFAKYGPNAERIHKGRIIEPVPRSRNRSRSR 120

Query: 121 SPRPRYRDEHRDKDYRRRSRSRSRERYDRDRYRSKERDHRRRSRSRSASPDRHKNHGRGK 180
           SPR RYRD+++D+DYR+RSRS+S +R++RD+YR +ERD+RR+SRSRSASPD  +  GRG+
Sbjct: 121 SPRRRYRDDYKDRDYRKRSRSKSLDRHERDKYRGRERDYRRQSRSRSASPDYSRGRGRGR 180

Query: 181 YDEERRSRSRSYESASPPRHSPNS-------KRSPSPRKTHKGEINPDERSPALKRVSPD 233
           YD+ERRS SRS  SASP R SP+        K SP P+       + D RSP  +  SP 
Sbjct: 181 YDDERRSSSRSMGSASPARRSPSPRRSRSPLKNSP-PKGASPDRRSRDGRSPTPRSASPH 239

Query: 234 GRRSVSRSLSPRRSPANE 251
           GR   SRS SPR S  +E
Sbjct: 240 GRAPASRSPSPRNSDVDE 257




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225459316|ref|XP_002285794.1| PREDICTED: uncharacterized protein LOC100243776 [Vitis vinifera] gi|302141951|emb|CBI19154.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|78191396|gb|ABB29919.1| unknown [Solanum tuberosum] Back     alignment and taxonomy information
>gi|356524836|ref|XP_003531034.1| PREDICTED: uncharacterized protein LOC100778928 [Glycine max] Back     alignment and taxonomy information
>gi|118484490|gb|ABK94120.1| unknown [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356512057|ref|XP_003524737.1| PREDICTED: uncharacterized protein LOC100804370 [Glycine max] Back     alignment and taxonomy information
>gi|224066947|ref|XP_002302293.1| predicted protein [Populus trichocarpa] gi|222844019|gb|EEE81566.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|148909922|gb|ABR18047.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|218200049|gb|EEC82476.1| hypothetical protein OsI_26921 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|297797433|ref|XP_002866601.1| hypothetical protein ARALYDRAFT_496619 [Arabidopsis lyrata subsp. lyrata] gi|297312436|gb|EFH42860.1| hypothetical protein ARALYDRAFT_496619 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query251
TAIR|locus:2173338303 SC35 "ortholog of human splici 0.430 0.356 0.907 6.1e-52
UNIPROTKB|P30352221 SRSF2 "Serine/arginine-rich sp 0.398 0.452 0.504 4.3e-22
UNIPROTKB|Q3MHR5221 SRSF2 "Serine/arginine-rich sp 0.398 0.452 0.504 4.3e-22
UNIPROTKB|E2RDB2221 SRSF2 "Uncharacterized protein 0.398 0.452 0.504 4.3e-22
UNIPROTKB|B4DN89209 SRSF2 "Serine/arginine-rich-sp 0.398 0.478 0.504 4.3e-22
UNIPROTKB|J3KP15134 SRSF2 "Serine/arginine-rich-sp 0.398 0.746 0.504 4.3e-22
UNIPROTKB|J3QL05130 SRSF2 "Serine/arginine-rich-sp 0.398 0.769 0.504 4.3e-22
UNIPROTKB|Q01130221 SRSF2 "Serine/arginine-rich sp 0.398 0.452 0.504 4.3e-22
UNIPROTKB|Q06A98221 SRSF2 "Serine/arginine-rich sp 0.398 0.452 0.504 4.3e-22
MGI|MGI:98284221 Srsf2 "serine/arginine-rich sp 0.398 0.452 0.504 4.3e-22
TAIR|locus:2173338 SC35 "ortholog of human splicing factor SC35" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 518 (187.4 bits), Expect = 6.1e-52, Sum P(2) = 6.1e-52
 Identities = 98/108 (90%), Positives = 103/108 (95%)

Query:     1 MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFA 60
             MSHFG+SGPPDI DTYSLLVLNITFRTTADDL+PLF KYGKVVDVFIPRDRRTGDSRGFA
Sbjct:     1 MSHFGRSGPPDISDTYSLLVLNITFRTTADDLYPLFAKYGKVVDVFIPRDRRTGDSRGFA 60

Query:    61 FVRYKYADEAQKAVDRLDGRVVDGREITVQFAKYGPNAEKIQQGRIVE 108
             FVRYKY DEA KAV+RLDGRVVDGREITVQFAKYGPNAEKI +GR+VE
Sbjct:    61 FVRYKYKDEAHKAVERLDGRVVDGREITVQFAKYGPNAEKISKGRVVE 108


GO:0000166 "nucleotide binding" evidence=IEA
GO:0003676 "nucleic acid binding" evidence=IEA
GO:0003723 "RNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0000398 "mRNA splicing, via spliceosome" evidence=RCA;TAS
GO:0016607 "nuclear speck" evidence=IDA
GO:0008380 "RNA splicing" evidence=NAS
GO:0016020 "membrane" evidence=IDA
GO:0005829 "cytosol" evidence=IDA
GO:0030422 "production of siRNA involved in RNA interference" evidence=RCA
GO:0035196 "production of miRNAs involved in gene silencing by miRNA" evidence=RCA
UNIPROTKB|P30352 SRSF2 "Serine/arginine-rich splicing factor 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3MHR5 SRSF2 "Serine/arginine-rich splicing factor 2" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDB2 SRSF2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DN89 SRSF2 "Serine/arginine-rich-splicing factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3KP15 SRSF2 "Serine/arginine-rich-splicing factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J3QL05 SRSF2 "Serine/arginine-rich-splicing factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q01130 SRSF2 "Serine/arginine-rich splicing factor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q06A98 SRSF2 "Serine/arginine-rich splicing factor 2" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:98284 Srsf2 "serine/arginine-rich splicing factor 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00015240001
SubName- Full=Chromosome chr18 scaffold_1, whole genome shotgun sequence; (257 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00001957001
SubName- Full=Chromosome chr5 scaffold_124, whole genome shotgun sequence; (169 aa)
       0.501
GSVIVG00014106001
SubName- Full=Chromosome chr16 scaffold_10, whole genome shotgun sequence; (224 aa)
      0.499
GSVIVG00031983001
SubName- Full=Chromosome chr18 scaffold_61, whole genome shotgun sequence; (264 aa)
       0.496
GSVIVG00010267001
SubName- Full=Chromosome undetermined scaffold_252, whole genome shotgun sequence; (241 aa)
       0.494
GSVIVG00025247001
SubName- Full=Chromosome chr9 scaffold_33, whole genome shotgun sequence; (257 aa)
       0.455
GSVIVG00011496001
SubName- Full=Chromosome chr10 scaffold_312, whole genome shotgun sequence; (226 aa)
       0.454
GSVIVG00002231001
SubName- Full=Chromosome chr14 scaffold_128, whole genome shotgun sequence; (224 aa)
       0.423
GSVIVG00006170001
SubName- Full=Chromosome undetermined scaffold_165, whole genome shotgun sequence; (209 aa)
      0.409
GSVIVG00019496001
SubName- Full=Chromosome chr7 scaffold_20, whole genome shotgun sequence; (206 aa)
       0.406

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
smart0036073 smart00360, RRM, RNA recognition motif 5e-24
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 1e-22
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 2e-21
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 1e-20
pfam0007670 pfam00076, RRM_1, RNA recognition motif 2e-20
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 6e-19
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 6e-18
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-17
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 1e-16
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 1e-15
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-15
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 1e-15
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 4e-15
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 4e-15
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 2e-14
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-14
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-14
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 6e-14
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 9e-14
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 3e-13
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 3e-13
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 3e-13
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-13
pfam1389356 pfam13893, RRM_5, RNA recognition motif 6e-13
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-12
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-12
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 2e-12
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 2e-12
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-12
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 3e-12
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 3e-12
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 4e-12
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 5e-12
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 5e-12
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 5e-12
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 6e-12
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 6e-12
cd1245077 cd12450, RRM1_NUCLs, RNA recognition motif 1 found 9e-12
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 1e-11
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 1e-11
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 1e-11
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 3e-11
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 4e-11
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 4e-11
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 4e-11
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 1e-10
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-10
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-10
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-10
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 2e-10
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 2e-10
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 3e-10
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 4e-10
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 4e-10
cd1240477 cd12404, RRM2_NCL, RNA recognition motif 2 in vert 5e-10
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 7e-10
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 8e-10
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-09
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 1e-09
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-09
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 1e-09
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 1e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 1e-09
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-09
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 2e-09
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-09
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 2e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 2e-09
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 2e-09
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-09
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 2e-09
cd1255984 cd12559, RRM_SRSF10, RNA recognition motif in seri 2e-09
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 2e-09
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 3e-09
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 3e-09
cd1237276 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif 3e-09
cd1256084 cd12560, RRM_SRSF12, RNA recognition motif in seri 4e-09
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 4e-09
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 6e-09
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 7e-09
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 8e-09
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-08
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 1e-08
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 1e-08
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 1e-08
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 1e-08
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 1e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-08
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-08
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 2e-08
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 2e-08
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 2e-08
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 3e-08
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 3e-08
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 4e-08
cd1228585 cd12285, RRM3_RBM39_like, RNA recognition motif 3 5e-08
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 5e-08
cd1231772 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition mot 6e-08
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 7e-08
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 7e-08
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 7e-08
cd1232271 cd12322, RRM2_TDP43, RNA recognition motif 2 in TA 8e-08
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 8e-08
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 8e-08
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-07
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 1e-07
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 1e-07
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 1e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-07
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-07
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 1e-07
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 1e-07
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 2e-07
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 2e-07
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 2e-07
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-07
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 2e-07
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 2e-07
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-07
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 2e-07
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 2e-07
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 5e-07
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 5e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 5e-07
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 5e-07
cd1231984 cd12319, RRM4_MRD1, RNA recognition motif 4 in yea 6e-07
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 7e-07
cd1237485 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition moti 9e-07
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 9e-07
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 1e-06
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-06
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 2e-06
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 2e-06
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 2e-06
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 2e-06
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-06
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 2e-06
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 2e-06
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 3e-06
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 3e-06
TIGR01661 352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 3e-06
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 3e-06
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 3e-06
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 4e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 4e-06
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 4e-06
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 4e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 5e-06
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 5e-06
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 5e-06
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 6e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 6e-06
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 6e-06
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 7e-06
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 7e-06
cd12287102 cd12287, RRM_U2AF35_like, RNA recognition motif in 7e-06
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 7e-06
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 8e-06
cd1240572 cd12405, RRM3_NCL, RNA recognition motif 3 in vert 8e-06
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 9e-06
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 9e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-05
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 1e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-05
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 1e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 1e-05
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 1e-05
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 1e-05
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 1e-05
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 1e-05
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 1e-05
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-05
cd1234974 cd12349, RRM2_SHARP, RNA recognition motif 2 in SM 2e-05
cd1245386 cd12453, RRM1_RIM4_like, RNA recognition motif 1 i 2e-05
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 2e-05
cd1230386 cd12303, RRM_spSet1p_like, RNA recognition motif i 2e-05
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 2e-05
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 2e-05
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-05
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 2e-05
cd1260371 cd12603, RRM_hnRNPC, RNA recognition motif in vert 2e-05
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 2e-05
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 2e-05
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 2e-05
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 3e-05
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 3e-05
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 3e-05
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 3e-05
cd1255685 cd12556, RRM2_RBM15B, RNA recognition motif 2 in p 3e-05
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 4e-05
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 4e-05
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 5e-05
cd1228291 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 5e-05
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 7e-05
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 7e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 7e-05
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 7e-05
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 7e-05
cd1246670 cd12466, RRM2_AtRSp31_like, RNA recognition motif 8e-05
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 9e-05
cd1255076 cd12550, RRM_II_PABPN1, RNA recognition motif in t 9e-05
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 9e-05
cd1248678 cd12486, RRM1_ACF, RNA recognition motif 1 found i 9e-05
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 1e-04
cd12540105 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 1e-04
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 1e-04
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 1e-04
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 1e-04
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 1e-04
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 1e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-04
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 2e-04
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 2e-04
cd1235074 cd12350, RRM3_SHARP, RNA recognition motif 3 in SM 2e-04
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 2e-04
cd1256872 cd12568, RRM3_MRD1, RNA recognition motif 3 in yea 3e-04
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 3e-04
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 4e-04
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 4e-04
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 4e-04
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 4e-04
cd1252771 cd12527, RRM2_EAR1_like, RNA recognition motif 2 i 5e-04
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 5e-04
cd1230493 cd12304, RRM_Set1, RNA recognition motif in the Se 5e-04
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 6e-04
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 6e-04
smart0036170 smart00361, RRM_1, RNA recognition motif 6e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 6e-04
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 6e-04
cd1242174 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition m 7e-04
cd1255177 cd12551, RRM_II_PABPN1L, RNA recognition motif in 7e-04
cd1222981 cd12229, RRM_G3BP, RNA recognition motif (RRM) in 7e-04
cd1246588 cd12465, RRM_UHMK1, RNA recognition motif found in 7e-04
cd1225379 cd12253, RRM_PIN4_like, RNA recognition motif in y 7e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 7e-04
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 8e-04
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 8e-04
cd1233872 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 9e-04
cd1264898 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 i 9e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 9e-04
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 0.001
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 0.001
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.001
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.001
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 0.001
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 0.001
PRK12678 672 PRK12678, PRK12678, transcription termination fact 0.001
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 0.001
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 0.002
cd1266898 cd12668, RRM3_RAVER2, RNA recognition motif 3 foun 0.002
cd1223982 cd12239, RRM2_RBM40_like, RNA recognition motif 2 0.002
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 0.002
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 0.002
cd1240375 cd12403, RRM1_NCL, RNA recognition motif 1 in vert 0.002
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 0.002
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 0.002
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 0.002
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 0.002
cd1275487 cd12754, RRM2_RBM10, RNA recognition motif 2 in ve 0.002
cd1229172 cd12291, RRM1_La, RNA recognition motif 1 in La au 0.002
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 0.002
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 0.003
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 0.003
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.003
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 0.004
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
 Score = 91.1 bits (227), Expect = 5e-24
 Identities = 32/73 (43%), Positives = 51/73 (69%)

Query: 17 SLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDR 76
          +L V N+   TT ++L  LF K+GKV  V + RD+ TG S+GFAFV ++  ++A+KA++ 
Sbjct: 1  TLFVGNLPPDTTEEELRELFSKFGKVESVRLVRDKETGKSKGFAFVEFESEEDAEKALEA 60

Query: 77 LDGRVVDGREITV 89
          L+G+ +DGR + V
Sbjct: 61 LNGKELDGRPLKV 73


Length = 73

>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240896 cd12450, RRM1_NUCLs, RNA recognition motif 1 found in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|240850 cd12404, RRM2_NCL, RNA recognition motif 2 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241003 cd12559, RRM_SRSF10, RNA recognition motif in serine/arginine-rich splicing factor 10 (SRSF10) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240818 cd12372, RRM_CFIm68_CFIm59, RNA recognition motif of pre-mRNA cleavage factor Im 68 kDa subunit (CFIm68 or CPSF6), pre-mRNA cleavage factor Im 59 kDa subunit (CFIm59 or CPSF7), and similar proteins Back     alignment and domain information
>gnl|CDD|241004 cd12560, RRM_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor 12 (SRSF12) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240731 cd12285, RRM3_RBM39_like, RNA recognition motif 3 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240763 cd12317, RRM4_RBM19_RRM3_MRD1, RNA recognition motif 4 in RNA-binding protein 19 (RBM19) and RNA recognition motif 3 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240768 cd12322, RRM2_TDP43, RNA recognition motif 2 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240765 cd12319, RRM4_MRD1, RNA recognition motif 4 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240820 cd12374, RRM_UHM_SPF45_PUF60, RNA recognition motif in UHM domain of 45 kDa-splicing factor (SPF45) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240733 cd12287, RRM_U2AF35_like, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor U2AF 35 kDa subunit (U2AF35) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240851 cd12405, RRM3_NCL, RNA recognition motif 3 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240795 cd12349, RRM2_SHARP, RNA recognition motif 2 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240899 cd12453, RRM1_RIM4_like, RNA recognition motif 1 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast Schizosaccharomyces pombe SET domain-containing protein 1 (spSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241047 cd12603, RRM_hnRNPC, RNA recognition motif in vertebrate heterogeneous nuclear ribonucleoprotein C1/C2 (hnRNP C1/C2) Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|241000 cd12556, RRM2_RBM15B, RNA recognition motif 2 in putative RNA binding motif protein 15B (RBM15B) from vertebrate Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240728 cd12282, RRM2_TatSF1_like, RNA recognition motif 2 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240912 cd12466, RRM2_AtRSp31_like, RNA recognition motif 2 in Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins from plants Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240994 cd12550, RRM_II_PABPN1, RNA recognition motif in type II polyadenylate-binding protein 2 (PABP-2) and similar proteins Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240930 cd12486, RRM1_ACF, RNA recognition motif 1 found in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240984 cd12540, RRM_U2AFBPL, RNA recognition motif in U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 1 (U2AFBPL) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240796 cd12350, RRM3_SHARP, RNA recognition motif 3 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241012 cd12568, RRM3_MRD1, RNA recognition motif 3 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|240971 cd12527, RRM2_EAR1_like, RNA recognition motif 2 in terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240750 cd12304, RRM_Set1, RNA recognition motif in the Set1-like family of histone-lysine N-methyltransferases Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|214637 smart00361, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240867 cd12421, RRM1_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240995 cd12551, RRM_II_PABPN1L, RNA recognition motif in vertebrate type II embryonic polyadenylate-binding protein 2 (ePABP-2) Back     alignment and domain information
>gnl|CDD|240675 cd12229, RRM_G3BP, RNA recognition motif (RRM) in ras GTPase-activating protein-binding protein G3BP1, G3BP2 and similar proteins Back     alignment and domain information
>gnl|CDD|240911 cd12465, RRM_UHMK1, RNA recognition motif found in U2AF homology motif kinase 1 (UHMK1) and similar proteins Back     alignment and domain information
>gnl|CDD|240699 cd12253, RRM_PIN4_like, RNA recognition motif in yeast RNA-binding protein PIN4, fission yeast RNA-binding post-transcriptional regulators cip1, cip2 and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240784 cd12338, RRM1_SRSF1_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 1 (SRSF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241092 cd12648, RRM3_UHM_PUF60, RNA recognition motif 3 in UHM domain of poly(U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|237171 PRK12678, PRK12678, transcription termination factor Rho; Provisional Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241112 cd12668, RRM3_RAVER2, RNA recognition motif 3 found in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240685 cd12239, RRM2_RBM40_like, RNA recognition motif 2 in RNA-binding protein 40 (RBM40) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240849 cd12403, RRM1_NCL, RNA recognition motif 1 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241198 cd12754, RRM2_RBM10, RNA recognition motif 2 in vertebrate RNA-binding protein 10 (RBM10) Back     alignment and domain information
>gnl|CDD|240737 cd12291, RRM1_La, RNA recognition motif 1 in La autoantigen (La or LARP3) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 251
KOG4207256 consensus Predicted splicing factor, SR protein su 99.93
KOG0107195 consensus Alternative splicing factor SRp20/9G8 (R 99.88
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.85
KOG0130170 consensus RNA-binding protein RBM8/Tsunagi (RRM su 99.78
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.77
KOG0113335 consensus U1 small nuclear ribonucleoprotein (RRM 99.77
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.76
KOG0121153 consensus Nuclear cap-binding protein complex, sub 99.74
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.74
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.72
KOG0122270 consensus Translation initiation factor 3, subunit 99.72
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.69
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.67
KOG0126219 consensus Predicted RNA-binding protein (RRM super 99.65
KOG0149247 consensus Predicted RNA-binding protein SEB4 (RRM 99.65
PLN03120260 nucleic acid binding protein; Provisional 99.65
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 99.65
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.64
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.64
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 99.63
KOG0125376 consensus Ataxin 2-binding protein (RRM superfamil 99.63
smart0036272 RRM_2 RNA recognition motif. 99.62
PLN03121243 nucleic acid binding protein; Provisional 99.62
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.61
PLN03213 759 repressor of silencing 3; Provisional 99.61
KOG0111298 consensus Cyclophilin-type peptidyl-prolyl cis-tra 99.61
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.61
KOG0114124 consensus Predicted RNA-binding protein (RRM super 99.6
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.6
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.59
KOG0117 506 consensus Heterogeneous nuclear ribonucleoprotein 99.59
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 99.59
smart0036071 RRM RNA recognition motif. 99.58
KOG0148321 consensus Apoptosis-promoting RNA-binding protein 99.58
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.57
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.56
TIGR01628562 PABP-1234 polyadenylate binding protein, human typ 99.56
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.55
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.55
KOG0108 435 consensus mRNA cleavage and polyadenylation factor 99.54
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.53
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.52
KOG0145360 consensus RNA-binding protein ELAV/HU (RRM superfa 99.51
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.49
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 99.48
KOG0127 678 consensus Nucleolar protein fibrillarin NOP77 (RRM 99.47
KOG0109 346 consensus RNA-binding protein LARK, contains RRM a 99.47
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.46
KOG0117506 consensus Heterogeneous nuclear ribonucleoprotein 99.46
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.45
KOG0415479 consensus Predicted peptidyl prolyl cis-trans isom 99.45
KOG4212 608 consensus RNA-binding protein hnRNP-M [RNA process 99.45
KOG0144 510 consensus RNA-binding protein CUGBP1/BRUNO (RRM su 99.44
KOG0146371 consensus RNA-binding protein ETR-3 (RRM superfami 99.43
smart0036170 RRM_1 RNA recognition motif. 99.43
KOG0147549 consensus Transcriptional coactivator CAPER (RRM s 99.42
KOG0124 544 consensus Polypyrimidine tract-binding protein PUF 99.4
KOG4208214 consensus Nucleolar RNA-binding protein NIFK [Gene 99.39
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.34
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 99.32
KOG0109346 consensus RNA-binding protein LARK, contains RRM a 99.31
KOG0131203 consensus Splicing factor 3b, subunit 4 [RNA proce 99.28
KOG0153377 consensus Predicted RNA-binding protein (RRM super 99.27
KOG0132 894 consensus RNA polymerase II C-terminal domain-bind 99.23
KOG0124544 consensus Polypyrimidine tract-binding protein PUF 99.22
KOG4212608 consensus RNA-binding protein hnRNP-M [RNA process 99.22
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.22
KOG0123369 consensus Polyadenylate-binding protein (RRM super 99.2
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 99.18
KOG4661 940 consensus Hsp27-ERE-TATA-binding protein/Scaffold 99.17
KOG0533243 consensus RRM motif-containing protein [RNA proces 99.15
KOG4676 479 consensus Splicing factor, arginine/serine-rich [R 99.15
KOG0110725 consensus RNA-binding protein (RRM superfamily) [G 99.15
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 99.13
KOG0146 371 consensus RNA-binding protein ETR-3 (RRM superfami 99.12
KOG4454267 consensus RNA binding protein (RRM superfamily) [G 99.09
KOG0116419 consensus RasGAP SH3 binding protein rasputin, con 99.08
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.07
KOG0123 369 consensus Polyadenylate-binding protein (RRM super 99.04
KOG4209231 consensus Splicing factor RNPS1, SR protein superf 99.04
KOG1457284 consensus RNA binding protein (contains RRM repeat 99.01
KOG4205311 consensus RNA-binding protein musashi/mRNA cleavag 99.0
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.96
KOG0105241 consensus Alternative splicing factor ASF/SF2 (RRM 98.91
KOG4660 549 consensus Protein Mei2, essential for commitment t 98.89
KOG1995351 consensus Conserved Zn-finger protein [General fun 98.89
KOG0106216 consensus Alternative splicing factor SRp55/B52/SR 98.82
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.81
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.78
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.76
KOG0151 877 consensus Predicted splicing regulator, contains R 98.75
KOG0226290 consensus RNA-binding proteins [General function p 98.69
KOG1190492 consensus Polypyrimidine tract-binding protein [RN 98.66
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.59
KOG4206221 consensus Spliceosomal protein snRNP-U1A/U2B [RNA 98.58
KOG2202260 consensus U2 snRNP splicing factor, small subunit, 98.57
KOG4849 498 consensus mRNA cleavage factor I subunit/CPSF subu 98.52
KOG1457284 consensus RNA binding protein (contains RRM repeat 98.51
KOG1456494 consensus Heterogeneous nuclear ribonucleoprotein 98.48
KOG4211 510 consensus Splicing factor hnRNP-F and related RNA- 98.46
KOG4676479 consensus Splicing factor, arginine/serine-rich [R 98.43
KOG0147 549 consensus Transcriptional coactivator CAPER (RRM s 98.42
KOG4210285 consensus Nuclear localization sequence binding pr 98.34
KOG1456 494 consensus Heterogeneous nuclear ribonucleoprotein 98.34
COG5175 480 MOT2 Transcriptional repressor [Transcription] 98.33
KOG2416718 consensus Acinus (induces apoptotic chromatin cond 98.29
KOG1190 492 consensus Polypyrimidine tract-binding protein [RN 98.28
KOG2314 698 consensus Translation initiation factor 3, subunit 98.23
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 98.21
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 98.21
KOG1548382 consensus Transcription elongation factor TAT-SF1 98.19
KOG3152278 consensus TBP-binding protein, activator of basal 98.17
KOG0129520 consensus Predicted RNA-binding protein (RRM super 98.17
KOG4307944 consensus RNA binding protein RBM12/SWAN [General 98.16
KOG0120500 consensus Splicing factor U2AF, large subunit (RRM 98.13
KOG1365508 consensus RNA-binding protein Fusilli, contains RR 98.09
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 98.0
KOG1855484 consensus Predicted RNA-binding protein [General f 97.88
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 97.77
KOG1996378 consensus mRNA splicing factor [RNA processing and 97.76
KOG0129520 consensus Predicted RNA-binding protein (RRM super 97.75
KOG1365 508 consensus RNA-binding protein Fusilli, contains RR 97.52
KOG4660549 consensus Protein Mei2, essential for commitment t 97.45
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.43
KOG0128881 consensus RNA-binding protein SART3 (RRM superfami 97.42
KOG4207256 consensus Predicted splicing factor, SR protein su 97.41
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 97.4
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 97.37
KOG2068327 consensus MOT2 transcription factor [Transcription 97.33
KOG4307 944 consensus RNA binding protein RBM12/SWAN [General 97.32
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 97.3
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 97.3
KOG0112 975 consensus Large RNA-binding protein (RRM superfami 97.21
KOG2591 684 consensus c-Mpl binding protein, contains La domai 97.11
KOG2135526 consensus Proteins containing the RNA recognition 97.05
KOG4285350 consensus Mitotic phosphoprotein [Cell cycle contr 97.05
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.95
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.86
KOG0115275 consensus RNA-binding protein p54nrb (RRM superfam 96.85
KOG2253 668 consensus U1 snRNP complex, subunit SNU71 and rela 96.62
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 96.6
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 96.59
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 96.27
KOG4574 1007 consensus RNA-binding protein (contains RRM and Pu 96.22
KOG4210285 consensus Nuclear localization sequence binding pr 95.9
KOG0804 493 consensus Cytoplasmic Zn-finger protein BRAP2 (BRC 95.75
KOG2318 650 consensus Uncharacterized conserved protein [Funct 95.65
KOG2193 584 consensus IGF-II mRNA-binding protein IMP, contain 94.94
KOG4483528 consensus Uncharacterized conserved protein [Funct 94.88
KOG4019193 consensus Calcineurin-mediated signaling pathway i 94.29
PF0753068 PRE_C2HC: Associated with zinc fingers; InterPro: 92.87
smart0059669 PRE_C2HC PRE_C2HC domain. 92.8
KOG4410396 consensus 5-formyltetrahydrofolate cyclo-ligase [C 91.76
PF03468116 XS: XS domain; InterPro: IPR005380 The XS (rice ge 90.39
COG5638 622 Uncharacterized conserved protein [Function unknow 90.07
KOG2295 648 consensus C2H2 Zn-finger protein [General function 89.38
PRK11901327 hypothetical protein; Reviewed 89.29
PRK10629127 EnvZ/OmpR regulon moderator; Provisional 88.65
KOG1295 376 consensus Nonsense-mediated decay protein Upf3 [RN 87.87
COG0724306 RNA-binding proteins (RRM domain) [General functio 85.92
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 85.53
KOG2891445 consensus Surface glycoprotein [General function p 85.33
KOG4365 572 consensus Uncharacterized conserved protein [Funct 85.14
cd0641097 PB1_UP2 Uncharacterized protein 2. The PB1 domain 84.55
TIGR0363677 L23_arch archaeal ribosomal protein L23. This mode 83.4
PRK1454884 50S ribosomal protein L23P; Provisional 82.72
PF0040362 HMA: Heavy-metal-associated domain; InterPro: IPR0 82.16
PRK11634629 ATP-dependent RNA helicase DeaD; Provisional 81.96
COG5193438 LHP1 La protein, small RNA-binding pol III transcr 80.41
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
Probab=99.93  E-value=1e-24  Score=171.49  Aligned_cols=99  Identities=53%  Similarity=0.835  Sum_probs=91.3

Q ss_pred             CCCCCCCCCCCCCCCcEEEEecCCCCCCHHHHHHHhhcCCCeeEEEEccCCCCCCcceEEEEEEecHHHHHHHHhhhCCC
Q 025553            1 MSHFGKSGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGR   80 (251)
Q Consensus         1 ~~~~~~~~~~~~~~~~~l~V~nLp~~~t~~~L~~~f~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~Ai~~l~g~   80 (251)
                      |++.+.  ||++...++|.|-||.+.++.++|..+|++||.|..|.|+.+..+++.+|||||.|.+..+|++||++|+|.
T Consensus         1 MS~g~~--PPdv~gm~SLkVdNLTyRTspd~LrrvFekYG~vgDVyIPrdr~Tr~sRgFaFVrf~~k~daedA~damDG~   78 (256)
T KOG4207|consen    1 MSYGRP--PPDVEGMTSLKVDNLTYRTSPDDLRRVFEKYGRVGDVYIPRDRYTRQSRGFAFVRFHDKRDAEDALDAMDGA   78 (256)
T ss_pred             CCCCCC--CCCcccceeEEecceeccCCHHHHHHHHHHhCcccceecccccccccccceeEEEeeecchHHHHHHhhcce
Confidence            666553  778888899999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCceEEEEeccCCCchhhh
Q 025553           81 VVDGREITVQFAKYGPNAEKI  101 (251)
Q Consensus        81 ~i~g~~l~v~~a~~~~~~~~~  101 (251)
                      +|+|..|.|++|+........
T Consensus        79 ~ldgRelrVq~arygr~~d~~   99 (256)
T KOG4207|consen   79 VLDGRELRVQMARYGRPSDLP   99 (256)
T ss_pred             eeccceeeehhhhcCCCcccc
Confidence            999999999999987765443



>KOG0107 consensus Alternative splicing factor SRp20/9G8 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG0130 consensus RNA-binding protein RBM8/Tsunagi (RRM superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0113 consensus U1 small nuclear ribonucleoprotein (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0121 consensus Nuclear cap-binding protein complex, subunit CBP20 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0122 consensus Translation initiation factor 3, subunit g (eIF-3g) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0126 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0149 consensus Predicted RNA-binding protein SEB4 (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0125 consensus Ataxin 2-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG0111 consensus Cyclophilin-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0114 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0148 consensus Apoptosis-promoting RNA-binding protein TIA-1/TIAR (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0108 consensus mRNA cleavage and polyadenylation factor I complex, subunit RNA15 [RNA processing and modification] Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0145 consensus RNA-binding protein ELAV/HU (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0127 consensus Nucleolar protein fibrillarin NOP77 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0117 consensus Heterogeneous nuclear ribonucleoprotein R (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0415 consensus Predicted peptidyl prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0144 consensus RNA-binding protein CUGBP1/BRUNO (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4208 consensus Nucleolar RNA-binding protein NIFK [General function prediction only] Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG0109 consensus RNA-binding protein LARK, contains RRM and retroviral-type Zn-finger domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG0131 consensus Splicing factor 3b, subunit 4 [RNA processing and modification] Back     alignment and domain information
>KOG0153 consensus Predicted RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0132 consensus RNA polymerase II C-terminal domain-binding protein RA4, contains RPR and RRM domains [RNA processing and modification; Transcription] Back     alignment and domain information
>KOG0124 consensus Polypyrimidine tract-binding protein PUF60 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4212 consensus RNA-binding protein hnRNP-M [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4661 consensus Hsp27-ERE-TATA-binding protein/Scaffold attachment factor (SAF-B) [Transcription] Back     alignment and domain information
>KOG0533 consensus RRM motif-containing protein [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0110 consensus RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0146 consensus RNA-binding protein ETR-3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4454 consensus RNA binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG0116 consensus RasGAP SH3 binding protein rasputin, contains NTF2 and RRM domains [Signal transduction mechanisms] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG0123 consensus Polyadenylate-binding protein (RRM superfamily) [RNA processing and modification; Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4209 consensus Splicing factor RNPS1, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG4205 consensus RNA-binding protein musashi/mRNA cleavage and polyadenylation factor I complex, subunit HRP1 [RNA processing and modification] Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG0105 consensus Alternative splicing factor ASF/SF2 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG1995 consensus Conserved Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0106 consensus Alternative splicing factor SRp55/B52/SRp75 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0151 consensus Predicted splicing regulator, contains RRM, SWAP and RPR domains [General function prediction only] Back     alignment and domain information
>KOG0226 consensus RNA-binding proteins [General function prediction only] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG4206 consensus Spliceosomal protein snRNP-U1A/U2B [RNA processing and modification] Back     alignment and domain information
>KOG2202 consensus U2 snRNP splicing factor, small subunit, and related proteins [RNA processing and modification] Back     alignment and domain information
>KOG4849 consensus mRNA cleavage factor I subunit/CPSF subunit [RNA processing and modification] Back     alignment and domain information
>KOG1457 consensus RNA binding protein (contains RRM repeats) [General function prediction only] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>KOG4211 consensus Splicing factor hnRNP-F and related RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>KOG4676 consensus Splicing factor, arginine/serine-rich [RNA processing and modification] Back     alignment and domain information
>KOG0147 consensus Transcriptional coactivator CAPER (RRM superfamily) [Transcription] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG1456 consensus Heterogeneous nuclear ribonucleoprotein L (contains RRM repeats) [RNA processing and modification] Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG2416 consensus Acinus (induces apoptotic chromatin condensation) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG1190 consensus Polypyrimidine tract-binding protein [RNA processing and modification] Back     alignment and domain information
>KOG2314 consensus Translation initiation factor 3, subunit b (eIF-3b) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG1548 consensus Transcription elongation factor TAT-SF1 [Transcription] Back     alignment and domain information
>KOG3152 consensus TBP-binding protein, activator of basal transcription (contains rrm motif) [Transcription] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG0120 consensus Splicing factor U2AF, large subunit (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG1855 consensus Predicted RNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG1996 consensus mRNA splicing factor [RNA processing and modification] Back     alignment and domain information
>KOG0129 consensus Predicted RNA-binding protein (RRM superfamily) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1365 consensus RNA-binding protein Fusilli, contains RRM domain [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4660 consensus Protein Mei2, essential for commitment to meiosis, and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG0128 consensus RNA-binding protein SART3 (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG4207 consensus Predicted splicing factor, SR protein superfamily [RNA processing and modification] Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>KOG2068 consensus MOT2 transcription factor [Transcription] Back     alignment and domain information
>KOG4307 consensus RNA binding protein RBM12/SWAN [General function prediction only] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG0112 consensus Large RNA-binding protein (RRM superfamily) [General function prediction only] Back     alignment and domain information
>KOG2591 consensus c-Mpl binding protein, contains La domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG2135 consensus Proteins containing the RNA recognition motif [General function prediction only] Back     alignment and domain information
>KOG4285 consensus Mitotic phosphoprotein [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG0115 consensus RNA-binding protein p54nrb (RRM superfamily) [RNA processing and modification] Back     alignment and domain information
>KOG2253 consensus U1 snRNP complex, subunit SNU71 and related PWI-motif proteins [RNA processing and modification] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>KOG4574 consensus RNA-binding protein (contains RRM and Pumilio-like repeats) [General function prediction only] Back     alignment and domain information
>KOG4210 consensus Nuclear localization sequence binding protein [Transcription] Back     alignment and domain information
>KOG0804 consensus Cytoplasmic Zn-finger protein BRAP2 (BRCA1 associated protein) [General function prediction only] Back     alignment and domain information
>KOG2318 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2193 consensus IGF-II mRNA-binding protein IMP, contains RRM and KH domains [RNA processing and modification; General function prediction only] Back     alignment and domain information
>KOG4483 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4019 consensus Calcineurin-mediated signaling pathway inhibitor DSCR1 [Signal transduction mechanisms; General function prediction only] Back     alignment and domain information
>PF07530 PRE_C2HC: Associated with zinc fingers; InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth Back     alignment and domain information
>smart00596 PRE_C2HC PRE_C2HC domain Back     alignment and domain information
>KOG4410 consensus 5-formyltetrahydrofolate cyclo-ligase [Coenzyme transport and metabolism] Back     alignment and domain information
>PF03468 XS: XS domain; InterPro: IPR005380 The XS (rice gene X and SGS3) domain is found in a family of plant proteins including gene X Q9SBW2 from SWISSPROT and SGS3 Q9LDX1 from SWISSPROT Back     alignment and domain information
>COG5638 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2295 consensus C2H2 Zn-finger protein [General function prediction only] Back     alignment and domain information
>PRK11901 hypothetical protein; Reviewed Back     alignment and domain information
>PRK10629 EnvZ/OmpR regulon moderator; Provisional Back     alignment and domain information
>KOG1295 consensus Nonsense-mediated decay protein Upf3 [RNA processing and modification] Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2891 consensus Surface glycoprotein [General function prediction only] Back     alignment and domain information
>KOG4365 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd06410 PB1_UP2 Uncharacterized protein 2 Back     alignment and domain information
>TIGR03636 L23_arch archaeal ribosomal protein L23 Back     alignment and domain information
>PRK14548 50S ribosomal protein L23P; Provisional Back     alignment and domain information
>PF00403 HMA: Heavy-metal-associated domain; InterPro: IPR006121 Proteins that transport heavy metals in micro-organisms and mammals share similarities in their sequences and structures Back     alignment and domain information
>PRK11634 ATP-dependent RNA helicase DeaD; Provisional Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 9e-22
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 7e-20
2dnm_A103 Solution Structure Of Rna Binding Domain In Srp46 S 1e-16
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 9e-11
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 3e-10
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 6e-10
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 9e-10
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 3e-09
1sxl_A97 Resonance Assignments And Solution Structure Of The 4e-09
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 1e-08
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 1e-08
1whw_A99 Solution Structure Of The N-Terminal Rna Binding Do 3e-08
3s7r_A87 Crystal Structure Of A Heterogeneous Nuclear Ribonu 4e-08
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 4e-08
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 1e-07
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 1e-07
2hyi_B91 Structure Of The Human Exon Junction Complex With A 1e-07
1p27_B106 Crystal Structure Of The Human Y14MAGOH COMPLEX Len 1e-07
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 1e-07
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 3e-07
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 3e-07
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 3e-07
4a8x_A88 Structure Of The Core Asap Complex Length = 88 4e-07
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 4e-07
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 4e-07
2err_A109 Nmr Structure Of The Rna Binding Domain Of Human Fo 5e-07
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 5e-07
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 5e-07
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 5e-07
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 5e-07
2j0s_D89 The Crystal Structure Of The Exon Junction Complex 5e-07
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 6e-07
2cq3_A103 Solution Structure Of Rna Binding Domain In Rna Bin 6e-07
2j0q_D109 The Crystal Structure Of The Exon Junction Complex 6e-07
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 7e-07
3pgw_S437 Crystal Structure Of Human U1 Snrnp Length = 437 1e-06
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 1e-06
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 1e-06
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 1e-06
3cw1_K216 Crystal Structure Of Human Spliceosomal U1 Snrnp Le 2e-06
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-06
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 2e-06
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 2e-06
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 2e-06
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 2e-06
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 2e-06
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 3e-06
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 3e-06
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 4e-06
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-06
1x4b_A116 Solution Structure Of Rrm Domain In Heterogeneous N 4e-06
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 4e-06
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 5e-06
1hd0_A75 Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D 6e-06
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 7e-06
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 7e-06
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 8e-06
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 1e-05
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 1e-05
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-05
2dgq_A108 Solution Structure Of The N-Terminal Rna Binding Do 2e-05
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 3e-05
2dgp_A106 Solution Structure Of The N-Terminal Rna Binding Do 3e-05
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 3e-05
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 4e-05
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 4e-05
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 4e-05
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 5e-05
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 6e-05
3lqv_A115 Branch Recognition By Sf3b14 Length = 115 6e-05
2f9j_A125 3.0 Angstrom Resolution Structure Of A Y22m Mutant 7e-05
2cqd_A116 Solution Structure Of The Rna Recognition Motif In 7e-05
2cpj_A99 Solution Structure Of The N-Terminal Rna Recognitio 7e-05
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 9e-05
2fc9_A101 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 9e-05
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 1e-04
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 1e-04
2fc8_A102 Solution Structure Of The Rrm_1 Domain Of Ncl Prote 2e-04
2f9d_A125 2.5 Angstrom Resolution Structure Of The Spliceosom 2e-04
1fjc_A96 Solution Structure Of Nucleolin Rbd2 Length = 96 2e-04
1wf2_A98 Solution Structure Of Rrm Domain In Hnrpc Protein L 2e-04
2fho_B87 Nmr Solution Structure Of The Human Spliceosomal Pr 2e-04
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 2e-04
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 4e-04
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 4e-04
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 4e-04
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 4e-04
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 4e-04
3pgw_A282 Crystal Structure Of Human U1 Snrnp Length = 282 5e-04
3ns5_A91 Crystal Structure Of The Rna Recognition Motif Of Y 5e-04
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 5e-04
3bs9_A87 X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 6e-04
3ns6_A100 Crystal Structure Of Hte Rna Recognition Motif Of Y 7e-04
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 7e-04
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure

Iteration: 1

Score = 100 bits (248), Expect = 9e-22, Method: Compositional matrix adjust. Identities = 49/87 (56%), Positives = 65/87 (74%) Query: 9 PPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYAD 68 PPD+ SL V N+T+RT+ D L +FEKYG+V DV+IPRDR T +SRGFAFVR+ Sbjct: 41 PPDVEGMTSLKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKR 100 Query: 69 EAQKAVDRLDGRVVDGREITVQFAKYG 95 +A+ A+D +DG V+DGRE+ VQ A+YG Sbjct: 101 DAEDAMDAMDGAVLDGRELRVQMARYG 127
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2DNM|A Chain A, Solution Structure Of Rna Binding Domain In Srp46 Splicing Factor Length = 103 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1WHW|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain From Hypothetical Protein Bab23448 Length = 99 Back     alignment and structure
>pdb|3S7R|A Chain A, Crystal Structure Of A Heterogeneous Nuclear Ribonucleoprotein AB (Hnrpab) From Homo Sapiens At 2.15 A Resolution Length = 87 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2HYI|B Chain B, Structure Of The Human Exon Junction Complex With A Trapped Dead-Box Helicase Bound To Rna Length = 91 Back     alignment and structure
>pdb|1P27|B Chain B, Crystal Structure Of The Human Y14MAGOH COMPLEX Length = 106 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|4A8X|A Chain A, Structure Of The Core Asap Complex Length = 88 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2ERR|A Chain A, Nmr Structure Of The Rna Binding Domain Of Human Fox-1 In Complex With Ugcaugu Length = 109 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2J0S|D Chain D, The Crystal Structure Of The Exon Junction Complex At 2.2 A Resolution Length = 89 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2CQ3|A Chain A, Solution Structure Of Rna Binding Domain In Rna Binding Motif Protein 9 Length = 103 Back     alignment and structure
>pdb|2J0Q|D Chain D, The Crystal Structure Of The Exon Junction Complex At 3.2 A Resolution Length = 109 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|3PGW|S Chain S, Crystal Structure Of Human U1 Snrnp Length = 437 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|3CW1|K Chain K, Crystal Structure Of Human Spliceosomal U1 Snrnp Length = 216 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|1X4B|A Chain A, Solution Structure Of Rrm Domain In Heterogeneous Nuclear Ribonucleaoproteins A2B1 Length = 116 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|1HD0|A Chain A, Heterogeneous Nuclear Ribonucleoprotein D0 (Hnrnp D0 Rbd1), Nmr Length = 75 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|2DGQ|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 6 Rna-Binding Protein Length = 108 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|2DGP|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Bruno-Like 4 Rna-Binding Protein Length = 106 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|3LQV|A Chain A, Branch Recognition By Sf3b14 Length = 115 Back     alignment and structure
>pdb|2F9J|A Chain A, 3.0 Angstrom Resolution Structure Of A Y22m Mutant Of The Spliceosomal Protein P14 Bound To A Region Of Sf3b155 Length = 125 Back     alignment and structure
>pdb|2CQD|A Chain A, Solution Structure Of The Rna Recognition Motif In Rna- Binding Region Containing Protein 1 Length = 116 Back     alignment and structure
>pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2FC9|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 101 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|2FC8|A Chain A, Solution Structure Of The Rrm_1 Domain Of Ncl Protein Length = 102 Back     alignment and structure
>pdb|2F9D|A Chain A, 2.5 Angstrom Resolution Structure Of The Spliceosomal Protein P14 Bound To Region Of Sf3b155 Length = 125 Back     alignment and structure
>pdb|1FJC|A Chain A, Solution Structure Of Nucleolin Rbd2 Length = 96 Back     alignment and structure
>pdb|1WF2|A Chain A, Solution Structure Of Rrm Domain In Hnrpc Protein Length = 98 Back     alignment and structure
>pdb|2FHO|B Chain B, Nmr Solution Structure Of The Human Spliceosomal Protein Complex P14-Sf3b155 Length = 87 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|3PGW|A Chain A, Crystal Structure Of Human U1 Snrnp Length = 282 Back     alignment and structure
>pdb|3NS5|A Chain A, Crystal Structure Of The Rna Recognition Motif Of Yeast Eif3b Residues 76-161 Length = 91 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|3BS9|A Chain A, X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 Back     alignment and structure
>pdb|3NS6|A Chain A, Crystal Structure Of Hte Rna Recognition Motif Of Yeast Eif3b Residues 76-170 Length = 100 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query251
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-30
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-29
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 9e-29
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-28
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 5e-28
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-27
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-25
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-25
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 7e-25
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 3e-24
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 4e-24
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 9e-24
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-23
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-23
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 4e-23
2cpj_A99 Non-POU domain-containing octamer-binding protein; 7e-23
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 7e-23
2cph_A107 RNA binding motif protein 19; RNA recognition moti 9e-23
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 1e-22
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-17
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-22
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-18
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 2e-22
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-22
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 2e-22
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-22
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 3e-22
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 6e-22
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-22
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 6e-22
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 6e-22
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 6e-22
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 7e-22
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 2e-21
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-21
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 5e-21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 9e-18
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 2e-14
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 8e-21
1x4e_A85 RNA binding motif, single-stranded interacting pro 1e-20
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-20
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-20
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 2e-20
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-20
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 2e-20
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 4e-20
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 4e-20
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-20
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 6e-20
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 9e-20
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-19
2la6_A99 RNA-binding protein FUS; structural genomics, nort 2e-19
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-19
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-19
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 6e-19
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 7e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-18
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-18
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 9e-10
2kt5_A124 RNA and export factor-binding protein 2; chaperone 2e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-18
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 2e-16
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-18
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-18
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-18
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 3e-18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-18
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-18
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-18
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 1e-14
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 4e-18
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 4e-18
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 1e-16
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 8e-18
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-17
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 1e-13
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-17
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-17
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 2e-17
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 3e-17
1x5o_A114 RNA binding motif, single-stranded interacting pro 3e-17
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 3e-17
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 3e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 4e-17
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 5e-13
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 4e-17
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-17
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 5e-17
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-15
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 5e-17
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 5e-17
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 5e-17
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 7e-17
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 7e-17
2cqd_A116 RNA-binding region containing protein 1; RNA recog 8e-17
3q2s_C229 Cleavage and polyadenylation specificity factor S; 9e-17
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 1e-16
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 7e-10
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 1e-16
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-16
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-16
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-16
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-16
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 1e-16
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-16
3n9u_C156 Cleavage and polyadenylation specificity factor S; 2e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 2e-16
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 3e-16
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 3e-16
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 4e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 4e-16
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-14
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 2e-13
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 7e-16
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 7e-16
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 8e-16
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 1e-15
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 1e-11
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 3e-15
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 4e-15
1x5p_A97 Negative elongation factor E; structure genomics, 6e-15
2i2y_A150 Fusion protein consists of immunoglobin G- binding 7e-15
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 9e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 1e-14
2div_A99 TRNA selenocysteine associated protein; structural 2e-14
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 2e-14
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 3e-14
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-14
2krb_A81 Eukaryotic translation initiation factor 3 subunit 3e-14
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-14
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-14
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 4e-14
2dis_A109 Unnamed protein product; structural genomics, RRM 6e-14
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 7e-14
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 7e-14
2f3j_A177 RNA and export factor binding protein 2; RRM domai 9e-14
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 9e-14
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-13
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 3e-12
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 1e-13
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 2e-13
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-13
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-13
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-10
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-13
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 4e-13
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 6e-13
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 9e-13
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 1e-12
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 3e-12
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 2e-11
2dit_A112 HIV TAT specific factor 1 variant; structural geno 3e-11
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 5e-11
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-11
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 5e-11
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-10
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-10
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 3e-10
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 3e-10
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 3e-10
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 4e-10
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 4e-10
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 4e-10
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 9e-10
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-09
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 1e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-09
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 2e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-09
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-09
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 4e-09
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 7e-09
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 1e-08
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-08
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-08
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 3e-08
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-08
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 4e-08
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-07
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 3e-07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 6e-07
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 7e-07
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 9e-07
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-06
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-06
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 1e-05
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 3e-05
3sqw_A579 ATP-dependent RNA helicase MSS116, mitochondrial; 5e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 7e-05
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 2e-04
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 4e-04
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
 Score =  107 bits (270), Expect = 3e-30
 Identities = 44/91 (48%), Positives = 59/91 (64%)

Query: 7  SGPPDIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKY 66
          S  PD+    +L V N+T+RT+ D L  +FEKYG+V DV+IPR+  T   RGFAFVR+  
Sbjct: 5  SSGPDVDGMITLKVDNLTYRTSPDSLRRVFEKYGRVGDVYIPREPHTKAPRGFAFVRFHD 64

Query: 67 ADEAQKAVDRLDGRVVDGREITVQFAKYGPN 97
            +AQ A   +DG  +DGRE+ VQ A+YG  
Sbjct: 65 RRDAQDAEAAMDGAELDGRELRVQVARYGRR 95


>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Length = 114 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} PDB: 3us5_A 2dny_A Length = 118 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Length = 105 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} Length = 579 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 102 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.92
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.9
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.88
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.88
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.87
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.87
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.87
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.87
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.87
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.87
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.87
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.87
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.87
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.87
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.87
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.87
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.87
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.86
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.86
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.86
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.86
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.86
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.86
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.86
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.86
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.86
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.86
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.86
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.86
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.86
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.86
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.86
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.86
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.86
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.85
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.85
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.85
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.85
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.85
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.85
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.85
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.85
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.85
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.85
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.85
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.85
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.85
2div_A99 TRNA selenocysteine associated protein; structural 99.85
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.85
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.85
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.85
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.84
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.84
2dis_A109 Unnamed protein product; structural genomics, RRM 99.84
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.84
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.84
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.84
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.84
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.84
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.84
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.84
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.84
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.84
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.84
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.84
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.84
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.83
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.83
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.83
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.83
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.83
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.83
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.83
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.83
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.83
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.83
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.83
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.83
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.83
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.82
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.82
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.82
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.82
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.82
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.82
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.82
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.82
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.82
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.82
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.82
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.82
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.82
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.82
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.82
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.82
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.82
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.82
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.82
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.82
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.82
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.82
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.81
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.81
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.81
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.81
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.81
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.81
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.81
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.81
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.81
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.81
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.81
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.81
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.81
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.81
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.81
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.81
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.8
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.8
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.8
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.8
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.8
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.8
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.79
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.79
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.79
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.79
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.79
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.79
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.79
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.79
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.66
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.79
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.79
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.78
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.78
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.78
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.78
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.78
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.78
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.77
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.77
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.77
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.77
1x5p_A97 Negative elongation factor E; structure genomics, 99.77
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.77
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.77
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.77
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.77
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.76
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.76
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.76
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.76
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.75
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.75
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.75
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.75
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.75
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.74
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.74
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.74
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.74
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 99.73
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.73
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.73
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.73
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 99.72
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 99.72
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.72
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 99.71
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.71
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.71
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.71
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.71
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 99.7
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.7
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.7
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.69
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.69
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 99.68
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.68
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.68
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.67
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 99.67
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.66
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.66
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.65
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.64
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.63
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.63
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.62
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.62
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.62
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.6
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.6
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.6
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.6
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.58
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.58
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.58
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.57
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.55
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.53
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.51
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.5
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.38
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.19
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.15
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.86
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.47
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.37
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.24
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 98.2
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 98.14
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 98.03
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 98.01
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 97.54
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.97
2i2y_A150 Fusion protein consists of immunoglobin G- binding 96.58
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 96.46
4eyt_A129 Telomerase associated protein P65; RNA, LA protein 95.76
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 95.1
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 94.78
2g0c_A76 ATP-dependent RNA helicase DBPA; RNA recognition m 93.58
4e8u_A172 Putative uncharacterized protein T8P19.180; XS dom 85.08
3fry_A73 Probable copper-exporting P-type ATPase A; transpo 83.8
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
Probab=99.92  E-value=1.6e-23  Score=188.68  Aligned_cols=85  Identities=27%  Similarity=0.523  Sum_probs=80.0

Q ss_pred             CCCcEEEEecCCCCCCHHHHHHHhhcCCCeeEEEEccCCCCCCcceEEEEEEecHHHHHHHHhhhCCCccCCceEEEEec
Q 025553           13 RDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQFA   92 (251)
Q Consensus        13 ~~~~~l~V~nLp~~~t~~~L~~~f~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~Ai~~l~g~~i~g~~l~v~~a   92 (251)
                      .+.++|||+|||+.||+++|+++|.+||.|+.|.|+.++.++.++|||||+|.+.++|++||++|||.+|+|..|.|+|+
T Consensus       100 ~~~~~lfV~nL~~~~te~~L~~~F~~~G~I~~v~i~~d~~tg~~kG~aFV~F~~~e~A~~Ai~~lng~~i~gr~i~V~~a  179 (437)
T 3pgw_S          100 DAFKTLFVARVNYDTTESKLRREFEVYGPIKRIHMVYSKRSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGRRVLVDVE  179 (437)
T ss_pred             CCCCEEEEeCCCCCCCHHHHHHHHHHcCCeeEEEeeccCCCCCccceEEEeeccHHHHHHHHHHcCCCEECCEEEEEEEe
Confidence            34579999999999999999999999999999999999889999999999999999999999999999999999999999


Q ss_pred             cCCCc
Q 025553           93 KYGPN   97 (251)
Q Consensus        93 ~~~~~   97 (251)
                      .+...
T Consensus       180 ~~~~~  184 (437)
T 3pgw_S          180 RGRTV  184 (437)
T ss_pred             CCCCC
Confidence            86543



>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4eyt_A Telomerase associated protein P65; RNA, LA protein, LARP7, RRM, XRRM, RNA binding protein; 2.50A {Tetrahymena thermophila} PDB: 4erd_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>2g0c_A ATP-dependent RNA helicase DBPA; RNA recognition motif, hydrolase; 1.70A {Bacillus subtilis} PDB: 3moj_B Back     alignment and structure
>4e8u_A Putative uncharacterized protein T8P19.180; XS domain, RNA binding protein, RNA directed DNA methylation; 2.70A {Arabidopsis thaliana} Back     alignment and structure
>3fry_A Probable copper-exporting P-type ATPase A; transport protein, metal binding domain, domain SWAP, ATP-BI cell membrane, copper transport; HET: CIT; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 251
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 8e-20
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-18
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 6e-17
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 1e-16
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 2e-15
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 2e-15
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-14
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-14
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 4e-14
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 8e-14
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 1e-13
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 2e-13
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 2e-13
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-13
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 2e-13
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 6e-13
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-13
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 8e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 2e-12
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-12
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-12
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 4e-12
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-12
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 5e-12
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 5e-12
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 8e-12
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 8e-12
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-11
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-06
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-11
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 2e-11
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 4e-11
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 7e-11
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 7e-11
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-10
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 2e-10
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 2e-10
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 4e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 5e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 5e-10
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-10
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 2e-09
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-09
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-09
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 5e-09
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 6e-09
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 8e-09
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 8e-09
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 1e-08
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 3e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-08
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 6e-08
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 6e-08
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 6e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 6e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 2e-07
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 3e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 4e-07
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 4e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 6e-07
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 2e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 4e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 4e-06
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 1e-05
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 3e-05
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 5e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-04
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-04
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 2e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 5e-04
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 0.001
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 0.001
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Poly(A)-binding protein
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 78.8 bits (194), Expect = 8e-20
 Identities = 19/77 (24%), Positives = 43/77 (55%)

Query: 17 SLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDR 76
          SL V ++    T   L+  F   G ++ + + RD  T  S G+A+V ++   +A++A+D 
Sbjct: 2  SLYVGDLHPDVTEAMLYEKFSPAGPILSIRVCRDMITRRSLGYAYVNFQQPADAERALDT 61

Query: 77 LDGRVVDGREITVQFAK 93
          ++  V+ G+ + + +++
Sbjct: 62 MNFDVIKGKPVRIMWSQ 78


>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query251
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.9
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.9
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.89
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.89
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.89
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.89
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.89
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.89
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.89
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.89
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.89
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.88
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.88
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.88
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.88
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.87
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.87
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.87
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.87
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.87
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.87
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.86
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.86
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.86
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.86
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.86
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.86
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.86
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.86
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.86
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.85
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.85
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.85
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.85
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.84
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.84
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.84
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.84
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.84
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.84
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.84
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.83
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.83
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.83
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.83
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.82
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.82
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.82
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.82
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.82
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.82
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.82
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.82
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.82
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.81
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.81
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.81
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.81
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.8
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.8
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.8
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.8
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.8
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.79
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.79
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.79
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.78
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.78
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.78
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.77
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.76
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.75
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.74
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.72
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.7
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.68
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.68
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.66
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.64
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.62
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.56
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.56
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.53
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.43
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.33
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.03
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 97.48
d1kvja_79 Menkes copper-transporting ATPase {Human (Homo sap 83.4
d1sc6a384 Phosphoglycerate dehydrogenase, regulatory (C-term 83.14
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: RNA-binding protein 8
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.90  E-value=9.1e-24  Score=147.58  Aligned_cols=85  Identities=28%  Similarity=0.477  Sum_probs=79.7

Q ss_pred             CCCCCcEEEEecCCCCCCHHHHHHHhhcCCCeeEEEEccCCCCCCcceEEEEEEecHHHHHHHHhhhCCCccCCceEEEE
Q 025553           11 DIRDTYSLLVLNITFRTTADDLFPLFEKYGKVVDVFIPRDRRTGDSRGFAFVRYKYADEAQKAVDRLDGRVVDGREITVQ   90 (251)
Q Consensus        11 ~~~~~~~l~V~nLp~~~t~~~L~~~f~~~G~i~~v~i~~~~~~g~~~g~afV~f~~~~~A~~Ai~~l~g~~i~g~~l~v~   90 (251)
                      ...++++|||+|||..+++++|.++|.+||+|..|.|+.++.+|.++|||||+|.+.++|+.||+.|||..|.|+.|.|+
T Consensus         3 ~s~~~~~l~V~nL~~~~t~~~l~~~F~~~G~i~~v~i~~d~~tg~~~g~afV~f~~~~~A~~A~~~lng~~l~g~~l~V~   82 (88)
T d1rk8a_           3 RSVEGWILFVTSIHEEAQEDEIQEKFCDYGEIKNIHLNLDRRTGFSKGYALVEYETHKQALAAKEALNGAEIMGQTIQVD   82 (88)
T ss_dssp             CCC-CEEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTSSEEEEEEEEESSHHHHHHHHHHHTTCEETTEECEEE
T ss_pred             CCCCCCEEEEeCCCCCCCHHHHHHHHHHcCCcccccccccccccccccceeEEECCHHHHHHHHHHcCCCEECCEEEEEE
Confidence            34568899999999999999999999999999999999998899999999999999999999999999999999999999


Q ss_pred             eccCC
Q 025553           91 FAKYG   95 (251)
Q Consensus        91 ~a~~~   95 (251)
                      ||.++
T Consensus        83 ~a~~k   87 (88)
T d1rk8a_          83 WCFVK   87 (88)
T ss_dssp             ESEEC
T ss_pred             EecCC
Confidence            99753



>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kvja_ d.58.17.1 (A:) Menkes copper-transporting ATPase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sc6a3 d.58.18.1 (A:327-410) Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure