Citrus Sinensis ID: 025567

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250

MKKPNNATAGSSKTKFKEESEEDNKTTSVTSSEEEEEIERELAEITFEDLLKARSDGSHLVYRKNSQEKKAGRANKNRPMEVSAKKPVSRFREVVQAPKRVVRDPRFESLCGNLDVEGFRKRYDFLFENTLPAEKEELKKQLKKTNDPNAVDKLKKRISWIDKQLRFESTKSTDAAILAEHKKKEREAAKHGKRPFYLKNSEIRKQRLIEKYNKLKGSGKVESFIEKRRRKNAAKDHKYMPYRRPNNNDQ

ccccccccccccccccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHccccHHccccccHHHcccccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccccccccccccc

*********************************************************************************************VVQAPKRVVRDPRFESLCGNLDVEGFRKRYDFLFENTLPA***********************RISWIDKQL******************************FYLKNSEIRK*********************************************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

MKKPNNATAGSSKTKFKEESEEDNKTTSVTSSEEEEEIERELAEITFEDLLKARSDGSHLVYRKNSQEKKAGRANKNRPMEVSAKKPVSRFREVVQAPKRVVRDPRFESLCGNLDVEGFRKRYDFLFENTLPAEKEELKKQLKKTNDPNAVDKLKKRISWIDKQLRFESTKSTDAAILAEHKKKEREAAKHGKRPFYxxxxxxxxxxxxxxxxxxxxxGKVESFIEKRRRKNAAKDHKYMPYRRPNNNDQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Ribosomal RNA processing protein 36 homolog	Involved in the early processing steps of the pre-rRNA in the maturation pathway leading to the 18S rRNA.	probable	A6QNR1

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!