BLASTP 2.2.26 [Sep-21-2011]
Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.
Reference for compositional score matrix adjustment: Altschul, Stephen F.,
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.
Query= 025572
(250 letters)
Database: pdbaa
62,578 sequences; 14,973,337 total letters
Searching..................................................done
>pdb|4H0P|A Chain A, Crystal Structure Of Acetate Kinase From Cryptococcus
Neoformans
pdb|4H0P|B Chain B, Crystal Structure Of Acetate Kinase From Cryptococcus
Neoformans
Length = 438
Score = 27.3 bits (59), Expect = 8.8, Method: Compositional matrix adjust.
Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 7/60 (11%)
Query: 159 IAGVILFGGLLAPSLEL-----KLGIGGTSYADFIQSV--HLPMQLSQVDPIVASFSGGA 211
IA + L P EL K G G SYA +QS+ HL Q++ +VA G+
Sbjct: 166 IAPEVYTYALPPPDTELTMPLRKYGFHGLSYASIVQSLAEHLKKPSDQINVVVAHLGSGS 225
Database: pdbaa
Posted date: Mar 3, 2013 10:34 PM
Number of letters in database: 14,973,337
Number of sequences in database: 62,578
Lambda K H
0.323 0.139 0.411
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,158,545
Number of Sequences: 62578
Number of extensions: 198462
Number of successful extensions: 308
Number of sequences better than 100.0: 2
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 1
Number of HSP's that attempted gapping in prelim test: 307
Number of HSP's gapped (non-prelim): 2
length of query: 250
length of database: 14,973,337
effective HSP length: 96
effective length of query: 154
effective length of database: 8,965,849
effective search space: 1380740746
effective search space used: 1380740746
T: 11
A: 40
X1: 16 ( 7.5 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 50 (23.9 bits)