Citrus Sinensis ID: 025599


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MRRRPGIGGLQSAAVARDQYRLLGENVAKLRTDLMKEQLATFRSQLEDFARKHKNDIRKNPTFRSQFHEMCAKVGVDPLASNKGFWAELLGIGDFYYELGVQIVEICLATRPHNGGLINLQELCNLLRQRRKSNREAVSEDDCLRAISKLKVLGNGYEVISVGKKKLVRSVPTELNKDHNQILELAQAQGFVTVDEVERRLSWTSGRAIDALDILLEEGLAMVDDGHRDRKRRYWFPCASSISSSMGADS
ccccccHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHccccccccccccccccccccccEEEcccHHHHHHHHccccccccEEHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccEEEEEEccEEEEEEccccccHHHHHHHHHHHHcccccHHHHHHHHcccccHHHHHHHHHHHcccccEEcccccccccEEccccccccccccccc
****PGIGGLQS**VARDQYRLLGENVAKLRTDLMKEQLATFRSQLEDFA***********TFRSQFHEMCAKVGVDPLASNKGFWAELLGIGDFYYELGVQIVEICLATRPHNGGLINLQELCNLLRQ*********SEDDCLRAISKLKVLGNGYEVISVGKKKLVRSVPTELNKDHNQILELAQAQGFVTVDEVERRLSWTSGRAIDALDILLEEGLAMVDDGHRDRKRRYWFPCAS**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRRPGIGGLQSAAVARDQYRLLGENVAKLRTDLMKEQLATFRSQLEDFARKHKNDIRKNPTFRSQFHEMCAKVGVDPLASNKGFWAELLGIGDFYYELGVQIVEICLATRPHNGGLINLQELCNLLRQRRKSNREAVSEDDCLRAISKLKVLGNGYEVISVGKKKLVRSVPTELNKDHNQILELAQAQGFVTVDEVERRLSWTSGRAIDALDILLEEGLAMVDDGHRDRKRRYWFPCASSISSSMGADS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 22 homolog 1 Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.confidentQ5M759
Vacuolar-sorting protein SNF8 Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex.probableQ5RJU0
Vacuolar-sorting protein SNF8 Component of the endosomal sorting complex required for transport II (ESCRT-II), which is required for multivesicular body (MVB) formation and sorting of endosomal cargo proteins into MVBs. The MVB pathway mediates delivery of transmembrane proteins into the lumen of the lysosome for degradation. The ESCRT-II complex is probably involved in the recruitment of the ESCRT-III complex. The ESCRT-II complex may also play a role in transcription regulation by participating in derepression of transcription by RNA polymerase II, possibly via its interaction with ELL. Required for degradation of both endocytosed EGF and EGFR, but not for the EGFR ligand-mediated internalization.probableQ9CZ28

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CUQ, chain A
Confidence level:very confident
Coverage over the Query: 33-245
View the alignment between query and template
View the model in PyMOL
Template: 1U5T, chain A
Confidence level:very confident
Coverage over the Query: 23-243
View the alignment between query and template
View the model in PyMOL