BLASTP 2.2.26 [Sep-21-2011]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= 025615
         (250 letters)

Database: pdbaa 
           62,578 sequences; 14,973,337 total letters

Searching..................................................done



>pdb|4A05|A Chain A, Structure Of The Catalytic Core Domain Of The
           Cellobiohydrolase, Cel6a, From Chaetomium Thermophilum
          Length = 364

 Score = 28.5 bits (62), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/50 (36%), Positives = 23/50 (46%), Gaps = 6/50 (12%)

Query: 160 WSMFCNGKKTGYGVKREAN--DEDFHVMELLRPVSMGGGVLPGNSDAEGA 207
           W  +CN K TG+GV+  AN   E       ++P    GG   G SD   A
Sbjct: 282 WGHWCNVKGTGFGVRPTANTGHELVDAFVWVKP----GGESDGTSDTSAA 327


>pdb|2IKF|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Utp
 pdb|2IKF|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Utp
 pdb|2NOM|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Dutp
 pdb|2NOM|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Dutp
 pdb|2Q0C|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Ctp
 pdb|2Q0C|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Ctp
 pdb|2Q0D|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Atp
 pdb|2Q0D|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Atp
 pdb|2Q0E|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Gtp
 pdb|2Q0E|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Gtp
 pdb|2Q0F|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Utp And Ump
 pdb|2Q0F|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Utp And Ump
 pdb|2Q0G|A Chain A, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Upu
 pdb|2Q0G|B Chain B, Terminal Uridylyl Transferase 4 From Trypanosoma Brucei
           With Bound Upu
          Length = 353

 Score = 28.1 bits (61), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 4/69 (5%)

Query: 157 EPLWSMFCNGKKTGYGVKREANDEDFHVMELLRPVSMGGGVLPGNSDAEGADGELAYIRA 216
           +PL  ++  G    YGV  + +D DF V+     V  G G   G++  + A G  A I A
Sbjct: 64  DPLMRLYTFGSTVVYGVHEKGSDVDFVVLN-KTDVEDGKG---GDAATQVAKGLQADILA 119

Query: 217 HFERVVGSK 225
              RV+  K
Sbjct: 120 KLARVIRQK 128


  Database: pdbaa
    Posted date:  Mar 3, 2013 10:34 PM
  Number of letters in database: 14,973,337
  Number of sequences in database:  62,578
  
Lambda     K      H
   0.315    0.135    0.397 

Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 6,386,195
Number of Sequences: 62578
Number of extensions: 258465
Number of successful extensions: 430
Number of sequences better than 100.0: 3
Number of HSP's better than 100.0 without gapping: 1
Number of HSP's successfully gapped in prelim test: 2
Number of HSP's that attempted gapping in prelim test: 429
Number of HSP's gapped (non-prelim): 3
length of query: 250
length of database: 14,973,337
effective HSP length: 96
effective length of query: 154
effective length of database: 8,965,849
effective search space: 1380740746
effective search space used: 1380740746
T: 11
A: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 50 (23.9 bits)