Query         025621
Match_columns 250
No_of_seqs    137 out of 1392
Neff          9.5 
Searched_HMMs 46136
Date          Fri Mar 29 07:43:33 2013
Command       hhsearch -i /work/01045/syshi/csienesis_hhblits_a3m/025621.a3m -d /work/01045/syshi/HHdatabase/Cdd.hhm -o /work/01045/syshi/hhsearch_cdd/025621hhsearch_cdd -cpu 12 -v 0 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 KOG1315 Predicted DHHC-type Zn 100.0 5.8E-37 1.3E-41  252.4   9.0  230    8-245    13-285 (307)
  2 KOG1314 DHHC-type Zn-finger pr 100.0 1.5E-33 3.3E-38  229.1  15.3  225    3-246    10-283 (414)
  3 KOG1311 DHHC-type Zn-finger pr  99.9 4.9E-27 1.1E-31  198.0  15.4  171   65-243    79-295 (299)
  4 PF01529 zf-DHHC:  DHHC palmito  99.9 1.2E-23 2.6E-28  164.0   7.7  130   57-186     2-174 (174)
  5 COG5273 Uncharacterized protei  99.9 4.2E-22 9.1E-27  166.8  14.6  202   41-242    55-304 (309)
  6 KOG1313 DHHC-type Zn-finger pr  99.9 5.6E-22 1.2E-26  157.0  13.3  145   94-240   101-304 (309)
  7 KOG0509 Ankyrin repeat and DHH  99.7 3.5E-18 7.7E-23  150.0   8.5  162   54-218   380-585 (600)
  8 KOG1312 DHHC-type Zn-finger pr  99.7 2.3E-17   5E-22  131.7   8.9   80   40-122    96-175 (341)
  9 COG5273 Uncharacterized protei  94.8    0.05 1.1E-06   46.2   4.7   98   92-189   120-248 (309)
 10 PF01529 zf-DHHC:  DHHC palmito  93.7   0.026 5.6E-07   43.6   0.8   28   92-119    59-86  (174)
 11 KOG1315 Predicted DHHC-type Zn  93.6    0.11 2.5E-06   43.7   4.5   50  200-249   248-298 (307)
 12 KOG1311 DHHC-type Zn-finger pr  93.3   0.034 7.3E-07   47.1   0.9   27   93-119   125-151 (299)
 13 KOG1314 DHHC-type Zn-finger pr  93.0   0.088 1.9E-06   44.6   3.0   62   57-119    68-129 (414)
 14 PF13240 zinc_ribbon_2:  zinc-r  91.8   0.091   2E-06   26.1   1.0   21   97-117     1-21  (23)
 15 PF10571 UPF0547:  Uncharacteri  89.1    0.19 4.1E-06   25.8   0.8   22   96-117     1-22  (26)
 16 PF13248 zf-ribbon_3:  zinc-rib  88.3    0.28 6.1E-06   25.1   1.1   22   96-117     3-24  (26)
 17 KOG1313 DHHC-type Zn-finger pr  87.9     0.2 4.3E-06   41.1   0.6   64   51-119    77-140 (309)
 18 PRK04136 rpl40e 50S ribosomal   86.3    0.36 7.8E-06   28.5   0.9   24   94-117    13-36  (48)
 19 PF07010 Endomucin:  Endomucin;  85.0     2.3   5E-05   34.0   5.0   38   43-80    195-232 (259)
 20 KOG0509 Ankyrin repeat and DHH  84.1    0.35 7.5E-06   44.1   0.2   29   91-119   430-458 (600)
 21 PRK15103 paraquat-inducible me  83.9      28  0.0006   31.1  12.0   29   94-122   220-248 (419)
 22 PTZ00303 phosphatidylinositol   79.6    0.83 1.8E-05   43.0   1.0   22   96-117   461-489 (1374)
 23 PHA02680 ORF090 IMV phosphoryl  77.4      12 0.00026   25.2   5.6   27  159-185    57-83  (91)
 24 KOG1312 DHHC-type Zn-finger pr  77.1    0.51 1.1E-05   39.0  -1.0   30   93-122   160-189 (341)
 25 COG2093 DNA-directed RNA polym  75.1     1.4 3.1E-05   27.5   0.8   23   95-117     4-26  (64)
 26 COG1552 RPL40A Ribosomal prote  73.8    0.73 1.6E-05   27.2  -0.7   24   94-117    13-36  (50)
 27 PF12773 DZR:  Double zinc ribb  71.4       3 6.5E-05   24.8   1.6   23   94-116    28-50  (50)
 28 PF00641 zf-RanBP:  Zn-finger i  69.0     1.7 3.8E-05   22.8   0.2   20   97-116     6-25  (30)
 29 TIGR00155 pqiA_fam integral me  68.7      43 0.00093   29.7   8.9   29   94-122   214-243 (403)
 30 PF01363 FYVE:  FYVE zinc finge  67.2     1.5 3.4E-05   28.0  -0.3   26   94-119     8-35  (69)
 31 KOG1842 FYVE finger-containing  66.3     1.4 3.1E-05   38.6  -0.7   29   94-122   179-209 (505)
 32 PF14127 DUF4294:  Domain of un  65.7     5.9 0.00013   30.0   2.5   33  173-218   102-134 (157)
 33 PF09889 DUF2116:  Uncharacteri  65.1      11 0.00024   23.5   3.3   23   95-117     3-26  (59)
 34 smart00064 FYVE Protein presen  64.4     4.3 9.4E-05   25.8   1.4   25   95-119    10-36  (68)
 35 PF01020 Ribosomal_L40e:  Ribos  59.7     4.5 9.8E-05   24.3   0.8   25   94-118    16-42  (52)
 36 cd00065 FYVE FYVE domain; Zinc  55.2     7.3 0.00016   23.6   1.2   23   96-118     3-27  (57)
 37 PRK02251 putative septation in  54.8      64  0.0014   21.8   6.6   32    4-35     29-60  (87)
 38 cd01995 ExsB ExsB is a transcr  54.3     7.1 0.00015   29.7   1.3   26   94-122   139-164 (169)
 39 PF08113 CoxIIa:  Cytochrome c   53.8      26 0.00056   19.0   2.9   23    1-23      1-23  (34)
 40 COG4640 Predicted membrane pro  53.1      28  0.0006   30.5   4.7   28   95-122     1-28  (465)
 41 KOG1841 Smad anchor for recept  53.1     7.2 0.00016   38.5   1.3   23   95-117   557-581 (1287)
 42 PRK03681 hypA hydrogenase nick  52.5     6.6 0.00014   28.1   0.8   24   94-117    69-95  (114)
 43 KOG1819 FYVE finger-containing  51.5     4.4 9.4E-05   36.3  -0.3   24   94-117   900-925 (990)
 44 PF06781 UPF0233:  Uncharacteri  50.4      78  0.0017   21.5   6.2   30    3-32     27-56  (87)
 45 PF07649 C1_3:  C1-like domain;  49.4     4.2 9.1E-05   21.3  -0.5   21   97-117     2-23  (30)
 46 PF07282 OrfB_Zn_ribbon:  Putat  48.5     8.1 0.00018   24.6   0.7   27   94-120    27-57  (69)
 47 KOG1818 Membrane trafficking a  47.7     7.7 0.00017   36.1   0.6   24   94-117   164-189 (634)
 48 PF02150 RNA_POL_M_15KD:  RNA p  45.8     5.4 0.00012   21.9  -0.4    7   96-102     2-8   (35)
 49 PRK00432 30S ribosomal protein  44.9     9.9 0.00021   22.8   0.6   23   94-116    19-44  (50)
 50 PF09297 zf-NADH-PPase:  NADH p  44.3     6.9 0.00015   20.9  -0.1   22   95-116     3-28  (32)
 51 PF03503 Chlam_OMP3:  Chlamydia  43.4      15 0.00032   21.6   1.2   21   96-116    24-44  (55)
 52 PRK02935 hypothetical protein;  42.1 1.2E+02  0.0026   21.3   6.9    8   96-103    87-94  (110)
 53 PF05814 DUF843:  Baculovirus p  41.7 1.1E+02  0.0023   20.5   5.4   23  165-188    38-60  (83)
 54 smart00661 RPOL9 RNA polymeras  40.8      10 0.00023   22.5   0.3    9   96-104    21-29  (52)
 55 TIGR00364 exsB protein. This p  38.3      16 0.00035   28.7   1.1   23   96-121   179-201 (201)
 56 smart00547 ZnF_RBZ Zinc finger  38.1      14 0.00031   18.4   0.5   20   97-116     4-23  (26)
 57 COG1579 Zn-ribbon protein, pos  37.3      32  0.0007   28.1   2.6   27   94-120   196-232 (239)
 58 PF04161 Arv1:  Arv1-like famil  36.9 1.2E+02  0.0025   24.2   5.8   16  107-122    22-37  (208)
 59 PF06508 QueC:  Queuosine biosy  36.8      19  0.0004   28.8   1.2   28   94-122   176-203 (209)
 60 TIGR00155 pqiA_fam integral me  36.8 1.2E+02  0.0026   26.9   6.4   29   94-122    12-46  (403)
 61 COG1852 Uncharacterized conser  36.6      14 0.00031   28.9   0.5   23  100-122   102-124 (209)
 62 PRK14559 putative protein seri  36.2      19 0.00041   34.0   1.3   28   95-122    27-54  (645)
 63 PF07754 DUF1610:  Domain of un  35.8      20 0.00043   17.9   0.8   19   98-116     1-23  (24)
 64 PHA02942 putative transposase;  35.0      17 0.00038   31.9   0.8   26   94-119   324-352 (383)
 65 PHA02898 virion envelope prote  34.8 1.5E+02  0.0032   20.1   6.3   25  157-181    54-79  (92)
 66 PRK13130 H/ACA RNA-protein com  34.0      21 0.00045   22.0   0.8   22   94-117     4-25  (56)
 67 TIGR02745 ccoG_rdxA_fixG cytoc  33.2 1.5E+02  0.0032   26.7   6.4   12  110-121   255-266 (434)
 68 PF06143 Baculo_11_kDa:  Baculo  32.9 1.6E+02  0.0034   19.9   4.9    8  170-177    56-63  (84)
 69 COG2956 Predicted N-acetylgluc  32.1      18  0.0004   31.0   0.5   26   93-118   352-377 (389)
 70 KOG0230 Phosphatidylinositol-4  31.3      22 0.00048   36.4   1.0   24   94-118     4-27  (1598)
 71 KOG1729 FYVE finger containing  31.0      11 0.00024   31.7  -1.0   26   94-119   167-195 (288)
 72 PRK14559 putative protein seri  30.9      26 0.00057   33.1   1.4   23   94-118    14-36  (645)
 73 PRK12380 hydrogenase nickel in  30.7      23 0.00051   25.2   0.8   24   94-117    69-94  (113)
 74 KOG2927 Membrane component of   30.4 1.1E+02  0.0024   26.5   4.8   16   98-113   266-281 (372)
 75 PRK15103 paraquat-inducible me  30.1 1.8E+02  0.0039   26.0   6.3   27   96-122    11-43  (419)
 76 PRK00159 putative septation in  29.9 1.8E+02  0.0039   19.7   6.6   29    4-32     28-56  (87)
 77 KOG4606 Uncharacterized conser  29.7 1.4E+02  0.0031   21.0   4.4   55    1-55     24-78  (126)
 78 PF03107 C1_2:  C1 domain;  Int  29.0      23 0.00051   18.5   0.4   20   97-116     2-22  (30)
 79 TIGR00100 hypA hydrogenase nic  29.0      27 0.00058   25.0   0.8   24   94-117    69-94  (115)
 80 PRK10692 hypothetical protein;  28.8 1.9E+02  0.0041   19.6   5.9   18   40-57     40-57  (92)
 81 PF12172 DUF35_N:  Rubredoxin-l  28.7      13 0.00029   20.4  -0.6   22   94-116    10-32  (37)
 82 PRK00564 hypA hydrogenase nick  28.1      29 0.00063   24.9   0.9   24   94-117    70-96  (117)
 83 PF12837 Fer4_6:  4Fe-4S bindin  27.8      26 0.00055   17.4   0.4    9  112-120     9-17  (24)
 84 PLN00186 ribosomal protein S26  27.8      18  0.0004   25.4  -0.2   14  109-122    20-33  (109)
 85 COG1600 Uncharacterized Fe-S p  27.3      31 0.00067   29.8   1.1   17  105-121   180-196 (337)
 86 COG1645 Uncharacterized Zn-fin  25.5      22 0.00047   26.1  -0.1    9  109-117    28-36  (131)
 87 PF10762 DUF2583:  Protein of u  25.4 2.2E+02  0.0047   19.2   5.8   17   41-57     41-57  (89)
 88 KOG1710 MYND Zn-finger and ank  25.2      33 0.00071   28.9   0.8   21   94-116   318-338 (396)
 89 PF12798 Fer4_3:  4Fe-4S bindin  25.0      32  0.0007   14.9   0.4    9  112-120     1-9   (15)
 90 COG0603 Predicted PP-loop supe  25.0      43 0.00092   27.1   1.4   18  105-122   188-205 (222)
 91 PF11023 DUF2614:  Protein of u  24.7 2.7E+02  0.0058   19.9   5.6    8   97-104    71-78  (114)
 92 PF00037 Fer4:  4Fe-4S binding   24.7      30 0.00065   17.0   0.3   10  111-120     7-16  (24)
 93 PRK09335 30S ribosomal protein  24.6      21 0.00046   24.5  -0.3   14  109-122    20-33  (95)
 94 KOG4399 C2HC-type Zn-finger pr  24.5      36 0.00079   28.0   0.9   23   95-118   261-283 (325)
 95 PF12387 Peptidase_C74:  Pestiv  24.4      36 0.00079   26.1   0.8   22   96-118   163-184 (200)
 96 PRK11106 queuosine biosynthesi  24.3      45 0.00097   27.1   1.4   25   96-122   183-207 (231)
 97 PF08772 NOB1_Zn_bind:  Nin one  24.2      32 0.00069   22.5   0.5   25   94-118     8-33  (73)
 98 PF06689 zf-C4_ClpX:  ClpX C4-t  24.2      48   0.001   18.8   1.1   27   96-122     2-34  (41)
 99 PTZ00172 40S ribosomal protein  24.0      23 0.00049   25.0  -0.3   14  109-122    20-33  (108)
100 cd00350 rubredoxin_like Rubred  22.6      59  0.0013   17.3   1.3   21   97-117     3-25  (33)
101 PRK06393 rpoE DNA-directed RNA  22.4      42 0.00092   21.3   0.7   22   94-117     4-25  (64)
102 PF14319 Zn_Tnp_IS91:  Transpos  22.0      50  0.0011   23.4   1.2   27   92-118    39-69  (111)
103 KOG4800 Neuronal membrane glyc  21.6   2E+02  0.0044   23.2   4.5   16  111-126   113-128 (248)
104 PF01976 DUF116:  Protein of un  21.0      55  0.0012   24.9   1.3   22  101-122    56-77  (158)
105 PF13829 DUF4191:  Domain of un  20.7 2.8E+02  0.0061   22.5   5.2   16    2-17     20-35  (224)
106 PF00130 C1_1:  Phorbol esters/  20.5      28 0.00062   20.6  -0.3   26   94-119    10-38  (53)
107 PRK14132 riboflavin kinase; Pr  20.1      38 0.00083   24.7   0.2   16   98-113    84-99  (126)

No 1  
>KOG1315 consensus Predicted DHHC-type Zn-finger protein [General function prediction only]
Probab=100.00  E-value=5.8e-37  Score=252.37  Aligned_cols=230  Identities=32%  Similarity=0.565  Sum_probs=174.8

Q ss_pred             chhHHHHHHHHHHHHHHHHHhhhccccccCCcchhHHHHHHHHHHHHHHHHHhHHHhcCCCCCCCCCCCCCcCCCCcchh
Q 025621            8 SLPVSVVVLAIFYIYFTTVFIFIDRWFGLMSSPGLMNAIVFTAVALMCVFSYTVAILRDPGRVPADYMPDVEDDQNPMHE   87 (250)
Q Consensus         8 ~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~~l~~~~~~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~   87 (250)
                      |+|++++...+++.|+++++.+...+.... +...+..++++.+.++.+|+|++++++|||.+|..+.++.++++.....
T Consensus        13 ~~~~~~i~~~~~~~yy~~v~~~c~~~i~~~-~~~~~~ll~~~~ll~m~~~sy~~~vf~~pg~vp~~~~~~~~~~~~~~~~   91 (307)
T KOG1315|consen   13 WIPVLIILLVIGWTYYVYVAVLCILSISLT-IPSVLLLLLFHLLLIMFLWSYFRTVFTDPGRVPDSYRPSVEDEDSLENG   91 (307)
T ss_pred             chhheeeeeeEEEEEEEeehhhhHHHHhhh-hHHHHHHHHHHHHHHHHHHHHHheeEecCCCCccccCCCcCcccccccc
Confidence            899999999999999999998888776653 5667778899999999999999999999999999988777766433221


Q ss_pred             ----------hhhcCCCcccccccccccCCCCCCCcchhhhhhhH---------------------HHHHHHHHH-----
Q 025621           88 ----------IKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRM---------------------VLLVGSLTN-----  131 (250)
Q Consensus        88 ----------~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~---------------------~~~~~~~~~-----  131 (250)
                                ..+..+..++|.+|+.+||+|||||++|+|||+||                     +++.+.++.     
T Consensus        92 ~~~~~~~~~~~~~~~g~~R~C~kC~~iKPdRaHHCsvC~rCvLKmDHHCpWi~nCVgf~NyKfF~lfl~y~~l~~~~~lv  171 (307)
T KOG1315|consen   92 SDNERDLPGYTRTSDGAVRYCDKCKCIKPDRAHHCSVCNRCVLKMDHHCPWINNCVGFRNYKFFLLFLFYTNLYSIYVLV  171 (307)
T ss_pred             CcccccceeeEecCCCCceeecccccccCCccccchhhhhhhhccccCCcceeceecccchHHHHHHHHHHHHHHHHHHH
Confidence                      13345688999999999999999999999999999                     112221111     


Q ss_pred             ----hhhhhhhc---cCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCcchHHHHhhhhHHHHHHhCCCcccCCCC
Q 025621          132 ----DSLEDELQ---TGGSFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRALWLAEKGGTVYKHPYD  204 (250)
Q Consensus       132 ----~~~~~~~~---~~~~~~~~~~~~~~l~~~~~~~~~~ll~~~~~li~~n~TT~E~~~~~~~~~~~~~~~~~~~n~yd  204 (250)
                          .+...+..   .........+++++++..+++.++.++++|+++|++|+||+|..+.....     .+...+|.|+
T Consensus       172 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~f~i~l~~~l~~h~~Li~~N~TTiE~~~~~~~~-----~~~~~~~~~~  246 (307)
T KOG1315|consen  172 TTLIGFTKYFQGGAGPSSLLLFFIVFLFLVAIAFSISLSGLLCFHTYLILKNKTTIEAYKSPVFR-----SGLHNKNGFN  246 (307)
T ss_pred             HHHHHHHHHHhccccCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcCchhHhhhcccccc-----ccccccCCcc
Confidence                11111111   11222344556667777888888889999999999999999999874221     1223456666


Q ss_pred             hhHHHhHHHhcCCCccceeccCcCCCCCCeeeccccCCccC
Q 025621          205 LGIFENLTSVLGPNIFSWVCPSSRHIGSGLNFRTAYHNAVG  245 (250)
Q Consensus       205 ~G~~~N~~~vfg~~~~~w~~P~~~~~~~g~~~~~~~~~~~~  245 (250)
                      .  ..|++++||.++..|++|...+.+||..++.+.+.-.+
T Consensus       247 ~--~~n~~~vfg~~~~~wl~P~~~s~~~~~~~~~~~~~~~~  285 (307)
T KOG1315|consen  247 L--YVNFREVFGSNLLYWLLPIDSSWGDGVSFPLRGDGLDF  285 (307)
T ss_pred             e--eecHHHHhCCCceEEeccccCccccCccccccccCCcc
Confidence            6  88999999999999999999888888888887664433


No 2  
>KOG1314 consensus DHHC-type Zn-finger protein [General function prediction only]
Probab=100.00  E-value=1.5e-33  Score=229.10  Aligned_cols=225  Identities=30%  Similarity=0.445  Sum_probs=161.7

Q ss_pred             CCcccchhHHHHHHHHHHHHHHHHHhhhccccccCCcchhHHHHHHHHHHHHHHHHHhHHHhcCCCCCCCCCCCCCcCCC
Q 025621            3 KGFTFSLPVSVVVLAIFYIYFTTVFIFIDRWFGLMSSPGLMNAIVFTAVALMCVFSYTVAILRDPGRVPADYMPDVEDDQ   82 (250)
Q Consensus         3 ~~~~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~~l~~~~~~~~~~~~~~dPG~~~~~~~~~~~~~~   82 (250)
                      |+.+.|-|+..+.. +.++.....+.-...|.+..+..+..+.+.|.+...+.+++|+.+++++||++|.++.|+...++
T Consensus        10 rr~~hwGpi~alsi-it~i~~~~~~~n~lww~p~ss~~g~~n~i~f~~~~~m~~~ny~~A~~~gPG~vp~~wkPe~~~D~   88 (414)
T KOG1314|consen   10 RRFLHWGPITALSI-ITIITSTTGYMNSLWWFPLSSFLGVPNQITFLLWTSMILYNYFNAIFTGPGFVPLGWKPENPKDE   88 (414)
T ss_pred             hheeccccHHHHHH-HHHHHHHHHHhhhhhhccccchhhhHHHHHHHHHHHHHHHHHHHHHhcCCCCCCCCCCCCCChhH
Confidence            46677878776543 44444444444444556666778889999999999999999999999999999999988766553


Q ss_pred             CcchhhhhcCCCcccccccccccCCCCCCCcchhhhhhhH---------------------HH---HHHHH---------
Q 025621           83 NPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRM---------------------VL---LVGSL---------  129 (250)
Q Consensus        83 ~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~---------------------~~---~~~~~---------  129 (250)
                                ...+||.+|+..|++|||||+.|||||.+|                     ++   .++++         
T Consensus        89 ----------~~lqfCk~CqgYKapRSHHCrkCnrCvmkMDHHCPWinnCVG~aNh~~F~~FLlf~ivG~ih~tiI~~~~  158 (414)
T KOG1314|consen   89 ----------MFLQFCKKCQGYKAPRSHHCRKCNRCVMKMDHHCPWINNCVGWANHAYFLRFLLFSIVGCIHGTIILVCA  158 (414)
T ss_pred             ----------HHHHHHhhccCcCCCccccchHHHHHHHhhccCCcchhhcccccccHHHHHHHHHHHHhcccceeeehhH
Confidence                      267999999999999999999999999999                     11   12211         


Q ss_pred             -HHhhhhhhhc-------cCCchhHHH----HHHHHHHHHHHHHHHHHHHHHHHHhccCcchHHHHhhhhHHHHH----H
Q 025621          130 -TNDSLEDELQ-------TGGSFRTAY----VISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRALWLA----E  193 (250)
Q Consensus       130 -~~~~~~~~~~-------~~~~~~~~~----~~~~~l~~~~~~~~~~ll~~~~~li~~n~TT~E~~~~~~~~~~~----~  193 (250)
                       +..++..|..       ....+....    ++..-+++...+++++|++.|+..|.+|+|.+|.+.-.++..++    .
T Consensus       159 ~~~~Iy~~W~~~~g~~hlp~v~ft~~~li~~vfslgla~gv~la~t~Lf~~qlk~Il~nrt~IE~wi~~Ka~~rr~~~~~  238 (414)
T KOG1314|consen  159 QYRGIYFRWYIKYGLRHLPIVFFTLSSLIALVFSLGLAIGVVLALTMLFFIQLKQILNNRTGIESWIVEKAMDRREYYFN  238 (414)
T ss_pred             HHHHHHHHHHhhcccccCceeeccHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHcCCcchHHHHHHHHHHHHHhhcc
Confidence             2222333311       111111111    22222335667888899999999999999999998754443332    2


Q ss_pred             hCCCcccCCCChhHHHhHHHhcCCCccceeccCcCCCCCCeeeccccCCccCC
Q 025621          194 KGGTVYKHPYDLGIFENLTSVLGPNIFSWVCPSSRHIGSGLNFRTAYHNAVGA  246 (250)
Q Consensus       194 ~~~~~~~n~yd~G~~~N~~~vfg~~~~~w~~P~~~~~~~g~~~~~~~~~~~~~  246 (250)
                      +...+..-|||.|++.|+++||-...        ...|||++||..+++.++.
T Consensus       239 d~~~~f~ypydlgWr~n~r~vf~~~~--------~~~gdg~~wPv~~gc~qyt  283 (414)
T KOG1314|consen  239 DDEGEFTYPYDLGWRINLREVFFQNK--------KEEGDGIEWPVVEGCVQYT  283 (414)
T ss_pred             CCCCceeeeccccccccHHHHhhhcc--------ccCCCCccccccCcccccc
Confidence            22245788999998899999997543        4689999999999998764


No 3  
>KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=99.95  E-value=4.9e-27  Score=197.96  Aligned_cols=171  Identities=32%  Similarity=0.480  Sum_probs=114.8

Q ss_pred             cCCCCCCCCCCCCCcC----CCCcchhhhhcCCCcccccccccccCCCCCCCcchhhhhhhH------------------
Q 025621           65 RDPGRVPADYMPDVED----DQNPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRM------------------  122 (250)
Q Consensus        65 ~dPG~~~~~~~~~~~~----~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~------------------  122 (250)
                      +|||.+|++.....+.    ......+.++...+.++|.+|+..||+|||||+.||+||.||                  
T Consensus        79 sdpg~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~rPpRs~HCsvC~~CV~rfDHHC~WvnnCVG~rNyr~  158 (299)
T KOG1311|consen   79 SDPGIVPRADDEQIEDPERAPLYKNVDVNGIQVEWKYCDTCQLYRPPRSSHCSVCNNCVLRFDHHCPWLNNCIGERNYRY  158 (299)
T ss_pred             CCCceecCcccCCCCCccccccCCCcccCCcccceEEcCcCcccCCCCcccchhhcccccccCCCCCCccceECCCchHH
Confidence            4999999963111111    111223345555689999999999999999999999999999                  


Q ss_pred             -HHHHH-----HHHHhh---hhhh--------hcc---CCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCcchHHH
Q 025621          123 -VLLVG-----SLTNDS---LEDE--------LQT---GGSFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEY  182 (250)
Q Consensus       123 -~~~~~-----~~~~~~---~~~~--------~~~---~~~~~~~~~~~~~l~~~~~~~~~~ll~~~~~li~~n~TT~E~  182 (250)
                       +.++.     +++...   ....        ...   ........++++++++++...++.|+.+|++++.+|+||+|+
T Consensus       159 F~~f~~~~~l~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~l~~fh~~li~~~~Tt~e~  238 (299)
T KOG1311|consen  159 FVLFLFYLALGVLLALAFLFYELLQRADNLKVNLTPVLIPAGTFLSALLGLLSALFLAFTSALLCFHIYLIKSGSTTYES  238 (299)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHhcccccccccccccchhHHHHHHHHHHHHHHHHHHHHHHHhheeeEecCcchhhh
Confidence             11111     111100   0000        001   112223334555666777788889999999999999999999


Q ss_pred             HhhhhHHHHHHhCCCcccCCCChhHHHhHHHhcCCC-ccceeccCc---CCCCCCeeeccccCCc
Q 025621          183 HEGVRALWLAEKGGTVYKHPYDLGIFENLTSVLGPN-IFSWVCPSS---RHIGSGLNFRTAYHNA  243 (250)
Q Consensus       183 ~~~~~~~~~~~~~~~~~~n~yd~G~~~N~~~vfg~~-~~~w~~P~~---~~~~~g~~~~~~~~~~  243 (250)
                      +++.+        .+...++||+|.++|++++||.+ ...|+.|..   +.+.+|-.|+.....+
T Consensus       239 ~~~~~--------~~~~~~~~~~g~~~n~~~~~~~~~~~~~~~p~~~~~~~p~~~~~~~~~~~~~  295 (299)
T KOG1311|consen  239 IKSLD--------FVSRSNPYDLGLLKNLQEVFGGPLPLSWLSPFARSGPLPHDGEGGPPTPHVS  295 (299)
T ss_pred             hhccc--------cccccCCCchhHHHHHHHHhCCCCCcccccccccCCCCCCCCCCCCcccccc
Confidence            88611        11125899999999999999975 489999986   4667788777666554


No 4  
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=99.89  E-value=1.2e-23  Score=164.01  Aligned_cols=130  Identities=32%  Similarity=0.540  Sum_probs=83.5

Q ss_pred             HHHhHHHhcCCCCCCCCCCCCCcCCC--------CcchhhhhcCCCcccccccccccCCCCCCCcchhhhhhhH------
Q 025621           57 FSYTVAILRDPGRVPADYMPDVEDDQ--------NPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCVLRM------  122 (250)
Q Consensus        57 ~~~~~~~~~dPG~~~~~~~~~~~~~~--------~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~------  122 (250)
                      ++|++++++|||++|.....+.+.++        ..+....+.....++|.+|+..||+|||||+.||+||.+|      
T Consensus         2 ~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~DHHC~w   81 (174)
T PF01529_consen    2 WSYFLTIFIDPGYVPRSNPDEDQRQEEKEEEQNQSIDSPEDDENGELKYCSTCKIIKPPRSHHCRVCNRCVLRFDHHCPW   81 (174)
T ss_pred             EEehhhheECCcccCCccccccccccccccccchhhhhhccccCCCCEECcccCCcCCCcceeccccccccccccccchh
Confidence            57889999999999987211111110        1111233345688999999999999999999999999999      


Q ss_pred             -----------H--H--HHHHHHH---------hhhhhhhc-cCCc---hhHH-HHHHHHHHHHHHHHHHHHHHHHHHHh
Q 025621          123 -----------V--L--LVGSLTN---------DSLEDELQ-TGGS---FRTA-YVISGLLLVPLSVALSVLLGWHIYLI  173 (250)
Q Consensus       123 -----------~--~--~~~~~~~---------~~~~~~~~-~~~~---~~~~-~~~~~~l~~~~~~~~~~ll~~~~~li  173 (250)
                                 +  +  +...+..         .+...... ....   .... .+++.++++++.++++.++++|++++
T Consensus        82 ~~~cIG~~N~~~F~~fl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~i  161 (174)
T PF01529_consen   82 LGNCIGRRNHRYFLLFLLYLCLYCLYFFILSLYYLVRYIPSISFSSFWIFSNFSSIFLLIISIFFFIFVGFLLIFQLYLI  161 (174)
T ss_pred             hccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhcccccccccchhhhHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence                       1  1  1111100         01011000 1111   1111 14445555777888899999999999


Q ss_pred             ccCcchHHHHhhh
Q 025621          174 FHNKTTIEYHEGV  186 (250)
Q Consensus       174 ~~n~TT~E~~~~~  186 (250)
                      ++|+||+|.++++
T Consensus       162 ~~n~Tt~E~~~~~  174 (174)
T PF01529_consen  162 LRNITTYERIKRK  174 (174)
T ss_pred             HcCCcHHHHHHcC
Confidence            9999999999863


No 5  
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=99.88  E-value=4.2e-22  Score=166.81  Aligned_cols=202  Identities=27%  Similarity=0.426  Sum_probs=131.0

Q ss_pred             hhHHHHHHHHHHHHHHHHHhHHHhcCCCCCCCCCCCCCcCCCCcchhhhhcCCCcccccccccccCCCCCCCcchhhhhh
Q 025621           41 GLMNAIVFTAVALMCVFSYTVAILRDPGRVPADYMPDVEDDQNPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCVL  120 (250)
Q Consensus        41 ~~~~~ii~~~l~~~~~~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV~  120 (250)
                      .....+.+.+...+..++++...+.|||+.+++.....-++..+..-..++.+..++|.+|+.+||+|||||+.||+||.
T Consensus        55 ~~~~~i~~~~i~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~KP~RS~HC~~Cn~CV~  134 (309)
T COG5273          55 VVLFIILFIVILVLASFSYLLLLVSDPGYLGENITLSGYRETISRLLDDGKFGTENFCSTCNIYKPPRSHHCSICNRCVL  134 (309)
T ss_pred             hhhhhhhhhhhhhhHHHhhHHHhhcCCCccCccccccchhhhhhhhhhcCccccceeccccccccCCCCccchhhcchhh
Confidence            33445666667778889999999999999986543333333222223444556889999999999999999999999999


Q ss_pred             hH-------------------HHHHHHH-----------HHhhhhhhhccCCchhH-HHHHH--HHHHHHHHHHHHHHHH
Q 025621          121 RM-------------------VLLVGSL-----------TNDSLEDELQTGGSFRT-AYVIS--GLLLVPLSVALSVLLG  167 (250)
Q Consensus       121 ~~-------------------~~~~~~~-----------~~~~~~~~~~~~~~~~~-~~~~~--~~l~~~~~~~~~~ll~  167 (250)
                      ||                   +.|+.+.           ...+............. ..++.  ..+...+++.+..++.
T Consensus       135 k~DHHC~Wi~nCVG~~N~r~F~~Fl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~~~~~~~f~~~~~~~~  214 (309)
T COG5273         135 KFDHHCPWINNCVGFRNYRFFYQFLLYTILVALVVLLSTAYYIAGIFSIRHDTSLAICFLIFGCSLLGVVFFIITTLLLL  214 (309)
T ss_pred             ccCccCcccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCChHHHHHHHHHhhhHHHHHHHHHHHHHHH
Confidence            99                   1111111           11111222222222222 22222  2333555667788999


Q ss_pred             HHHHHhccCcchHHHHhhhhHHHHHH-------h--------CCCcccCCCChhHHHhHHHhcCCCccceeccCcCCCCC
Q 025621          168 WHIYLIFHNKTTIEYHEGVRALWLAE-------K--------GGTVYKHPYDLGIFENLTSVLGPNIFSWVCPSSRHIGS  232 (250)
Q Consensus       168 ~~~~li~~n~TT~E~~~~~~~~~~~~-------~--------~~~~~~n~yd~G~~~N~~~vfg~~~~~w~~P~~~~~~~  232 (250)
                      ++.+++..|+||+|.....|..+..+       .        +..+...|++.|.-+|+..+++.+...|..|......+
T Consensus       215 ~~~~~~~~~~t~~e~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~~~~~  294 (309)
T COG5273         215 FLIYLILNNLTTIEFIQISRGGSTLEFFPLCRESNLPFTNIFDSSEGALPLDLGIGQNLSTIKGSNALYWLTPLHTNYCN  294 (309)
T ss_pred             HHHHHHHhhHHHHHHHHhccceecccccchhccCCcCceeccCCCccccccccCccccceeecCCCceeeccccccCCCC
Confidence            99999999999999998766533211       1        11123467788888999999999888999885422256


Q ss_pred             CeeeccccCC
Q 025621          233 GLNFRTAYHN  242 (250)
Q Consensus       233 g~~~~~~~~~  242 (250)
                      +.+++.+.+.
T Consensus       295 ~~~~~~~~~~  304 (309)
T COG5273         295 SYDFSLRSDT  304 (309)
T ss_pred             ccCcccchhh
Confidence            6666665543


No 6  
>KOG1313 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=99.88  E-value=5.6e-22  Score=157.04  Aligned_cols=145  Identities=26%  Similarity=0.360  Sum_probs=101.1

Q ss_pred             CcccccccccccCCCCCCCcchhhhhhhH-------------------HHHH-----HHH-------HHhhhhhhh----
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKRCVLRM-------------------VLLV-----GSL-------TNDSLEDEL----  138 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~-------------------~~~~-----~~~-------~~~~~~~~~----  138 (250)
                      ...+|.+|..+||+|+|||++|||||++|                   ++|+     ++.       +.|......    
T Consensus       101 ~~SfC~KC~~pK~prTHHCsiC~kCVL~MDHHCPwinnCVG~~NHryFFlFl~~ltlat~~~~i~~~~~w~~~le~~~~~  180 (309)
T KOG1313|consen  101 NDSFCNKCNYPKSPRTHHCSICNKCVLKMDHHCPWINNCVGAHNHRYFFLFLFYLTLATSYAAIMCVYTWIDHLEPIEEI  180 (309)
T ss_pred             cccHHhhcCCCCCCCcchhhHHhhHhhccccCCchhhcccccccchhHHHHHHHHHHHHHHHHHHHHHHHHHhcchHhhc
Confidence            44899999999999999999999999999                   1111     111       111110000    


Q ss_pred             --ccCC----------------chhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCcchHHHHhhhhHHHHHHhCCCccc
Q 025621          139 --QTGG----------------SFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRALWLAEKGGTVYK  200 (250)
Q Consensus       139 --~~~~----------------~~~~~~~~~~~l~~~~~~~~~~ll~~~~~li~~n~TT~E~~~~~~~~~~~~~~~~~~~  200 (250)
                        ...+                ........+.++++.+.++++.+..+|..+|.+|.|++|+....++++...+.+  ..
T Consensus       181 tay~~d~~h~~Pp~~i~r~~~~i~~t~~~~~~fls~~~lv~vg~l~~W~~vlI~~G~tsi~~~~~~~e~k~~~a~~--R~  258 (309)
T KOG1313|consen  181 TAYASDVAHVAPPPSILRVYKNITRTSIANLWFLSVRVLVAVGLLTAWHAVLISRGETSIEQLINIKERKRYLAHL--RS  258 (309)
T ss_pred             ccccCcccccCCChhhhhhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHhheeeehhhhhHHHHHHHHHhHhHHHhc--cC
Confidence              0000                001112345566667788889999999999999999999998877766555544  38


Q ss_pred             CCCChhHHHhHHHhcCC-C-c---cceeccCc-CCCCCCeeecccc
Q 025621          201 HPYDLGIFENLTSVLGP-N-I---FSWVCPSS-RHIGSGLNFRTAY  240 (250)
Q Consensus       201 n~yd~G~~~N~~~vfg~-~-~---~~w~~P~~-~~~~~g~~~~~~~  240 (250)
                      ||++.|..+||+.++|- + +   ..-++|.. +..+.|-.||..+
T Consensus       259 ~~~n~g~k~nWr~fLg~~~~r~~wk~v~lPt~~~p~~~~~~~~~~d  304 (309)
T KOG1313|consen  259 NPTNFGGKANWRNFLGLFRGRHFWKTVLLPTIRKPVKYGDSKEKSD  304 (309)
T ss_pred             CCcccchHHHHHHhhccccCCceeEEEeccccccccccCCcccccc
Confidence            99999999999999984 2 2   23388986 6666788888443


No 7  
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]
Probab=99.75  E-value=3.5e-18  Score=149.97  Aligned_cols=162  Identities=21%  Similarity=0.243  Sum_probs=91.7

Q ss_pred             HHHHHHhHHHhcCCCCCCCCCCCCCcCCCCcchhhhhcCCCc-ccccccccccCCCCCCCcchhhhhhhH----------
Q 025621           54 MCVFSYTVAILRDPGRVPADYMPDVEDDQNPMHEIKRKGGDL-RYCQKCSHYKPPRAHHCRVCKRCVLRM----------  122 (250)
Q Consensus        54 ~~~~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~C~~C~~~kp~Rs~HC~~C~~CV~~~----------  122 (250)
                      ..++.+.+...+|||++|......  .+.+......++.... ++|.+|.++||.|||||+.|||||.||          
T Consensus       380 ~~~~~f~~~~rsDPg~i~~~~~~~--~~tIs~l~d~gkf~~en~FC~~clirKp~rSkhc~vcnrcVarfDHhCPwi~nc  457 (600)
T KOG0509|consen  380 AYFITFGLFLRSDPGFIPTSTEVG--RETISQLIDFGKFDLENRFCLTCLIRKPLRSKHCSVCNRCVARFDHHCPWIGNC  457 (600)
T ss_pred             HHHHHHHHHhccCCCCCCCchhhH--HHHHHHhhccccccccccceeeeeeecCCccchhhhhHHHHhccccCCCccccc
Confidence            334455556669999999763222  1111111111222233 799999999999999999999999999          


Q ss_pred             ---------HHHHHHHHH------hh-hhhhhccCCchhHHH-HHHHHHHHHH----------------HHHHHHHHHHH
Q 025621          123 ---------VLLVGSLTN------DS-LEDELQTGGSFRTAY-VISGLLLVPL----------------SVALSVLLGWH  169 (250)
Q Consensus       123 ---------~~~~~~~~~------~~-~~~~~~~~~~~~~~~-~~~~~l~~~~----------------~~~~~~ll~~~  169 (250)
                               .+++.++..      +. ...+........+.. .+..+.+...                ....+..-+.|
T Consensus       458 VG~kNh~~F~~Fl~~l~~~~~~~l~~~~~y~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~n~~~~~t~~~~~~~~~~  537 (600)
T KOG0509|consen  458 VGLKNHRLFVFFLLTLLTVIVFYLYLCLYYIMNLENASTIYVGFLIAVQAFRIPKPVTGNLLGNEDLNPTWGSTSTKCQH  537 (600)
T ss_pred             cCccchHHHHHHHHHHHHHHHHHHHHHHHHHhhcchhHHHHHHHHHHHHHHhCCccceeeeeeccccccccccccccccc
Confidence                     111111100      00 001111111101111 1111111000                01111222334


Q ss_pred             HHHhccCcchHHHHhhhhHHHHHHhCCCcccCCCChhHHHhHHHhcCCC
Q 025621          170 IYLIFHNKTTIEYHEGVRALWLAEKGGTVYKHPYDLGIFENLTSVLGPN  218 (250)
Q Consensus       170 ~~li~~n~TT~E~~~~~~~~~~~~~~~~~~~n~yd~G~~~N~~~vfg~~  218 (250)
                      ...++.+.||+|+++.+|+++...+.+. ..+|++.|..+|+.+|+-.+
T Consensus       538 ~~~~c~~~tt~e~~n~~r~~~~~~~~~~-~~~~~s~g~~~Nl~df~~~~  585 (600)
T KOG0509|consen  538 YNCACLHLTTNEQINVKRYEHLGIKRGP-TRSPFSPGPIRNLVDFFLCS  585 (600)
T ss_pred             cceeeecccHHHHHHHHHhhccccccCc-CCCCCCchhhhcchheeecc
Confidence            4568999999999999999877755543 67999999999999999643


No 8  
>KOG1312 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=99.72  E-value=2.3e-17  Score=131.71  Aligned_cols=80  Identities=23%  Similarity=0.344  Sum_probs=57.5

Q ss_pred             chhHHHHHHHHHHHHHHHHHhHHHhcCCCCCCCCCCCCCcCCCCcchhhhhcCCCcccccccccccCCCCCCCcchhhhh
Q 025621           40 PGLMNAIVFTAVALMCVFSYTVAILRDPGRVPADYMPDVEDDQNPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCV  119 (250)
Q Consensus        40 ~~~~~~ii~~~l~~~~~~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV  119 (250)
                      .+..+.+....++++-..++..++.+|||.+.++.........+-+....   -+...|+||++.||.|||||+.||+||
T Consensus        96 lsl~~~il~~l~vivp~i~f~ltc~snpg~i~k~n~s~~~~~ypYDy~if---~k~~kCSTCki~KPARSKHCsiCNrCV  172 (341)
T KOG1312|consen   96 LSLHYLILPYLLVIVPLIFFTLTCGSNPGIITKANESLFLHVYPYDYVIF---PKNVKCSTCKIRKPARSKHCSICNRCV  172 (341)
T ss_pred             hhHHHHHHHHHHHHHHHHHHhhhhcCCCCccchhhhccceeccCccceee---cCCCccccccCCCccccccchHHHHHH
Confidence            45566666666666777888889999999998753322222222111111   134899999999999999999999999


Q ss_pred             hhH
Q 025621          120 LRM  122 (250)
Q Consensus       120 ~~~  122 (250)
                      .||
T Consensus       173 ~rf  175 (341)
T KOG1312|consen  173 HRF  175 (341)
T ss_pred             HHh
Confidence            999


No 9  
>COG5273 Uncharacterized protein containing DHHC-type Zn finger [General function prediction only]
Probab=94.76  E-value=0.05  Score=46.17  Aligned_cols=98  Identities=18%  Similarity=0.191  Sum_probs=57.8

Q ss_pred             CCCcccccccccccCCCCCCCcchhhhh--------hhH-----------HHHHHHHHHhhhhh------h---hc-c--
Q 025621           92 GGDLRYCQKCSHYKPPRAHHCRVCKRCV--------LRM-----------VLLVGSLTNDSLED------E---LQ-T--  140 (250)
Q Consensus        92 ~~~~~~C~~C~~~kp~Rs~HC~~C~~CV--------~~~-----------~~~~~~~~~~~~~~------~---~~-~--  140 (250)
                      ..+.++|..|+......+|||..-|+||        ..|           +......+......      .   .. .  
T Consensus       120 P~RS~HC~~Cn~CV~k~DHHC~Wi~nCVG~~N~r~F~~Fl~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~li~~~~  199 (309)
T COG5273         120 PPRSHHCSICNRCVLKFDHHCPWINNCVGFRNYRFFYQFLLYTILVALVVLLSTAYYIAGIFSIRHDTSLAICFLIFGCS  199 (309)
T ss_pred             CCCCccchhhcchhhccCccCcccccccCcchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhccccCChHHHHHHHHHhhh
Confidence            4578999999999999999999999998        555           22223322211100      0   00 0  


Q ss_pred             CCchhHHHHHHHHHHHHHHHHHHHHHHHHHHHhccCcchHHHHhhhhHH
Q 025621          141 GGSFRTAYVISGLLLVPLSVALSVLLGWHIYLIFHNKTTIEYHEGVRAL  189 (250)
Q Consensus       141 ~~~~~~~~~~~~~l~~~~~~~~~~ll~~~~~li~~n~TT~E~~~~~~~~  189 (250)
                      ......+++...++......++-.....+.+.+.++.++-|...-.++.
T Consensus       200 ~~~~~~f~~~~~~~~~~~~~~~~~~t~~e~~~~~~~~~~~~~~~~~~~~  248 (309)
T COG5273         200 LLGVVFFIITTLLLLFLIYLILNNLTTIEFIQISRGGSTLEFFPLCRES  248 (309)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHhccceecccccchhccC
Confidence            0111111222222223344555567777888999999998886554444


No 10 
>PF01529 zf-DHHC:  DHHC palmitoyltransferase;  InterPro: IPR001594 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the DHHC-type zinc finger domain, which is also known as NEW1 []. The DHHC Zn-finger was first isolated in the Drosophila putative transcription factor DNZ1 and was named after a conserved sequence motif []. This domain has palmitoyltransferase activity; this post-translational modification attaches the C16 saturated fatty acid palmitate via a thioester linkage, predominantly to cysteine residues []. This domain is found in the DHHC proteins which are palmitoyl transferases []; the DHHC motif is found within a cysteine-rich domain which is thought to contain the catalytic site. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding
Probab=93.70  E-value=0.026  Score=43.56  Aligned_cols=28  Identities=21%  Similarity=0.483  Sum_probs=25.6

Q ss_pred             CCCcccccccccccCCCCCCCcchhhhh
Q 025621           92 GGDLRYCQKCSHYKPPRAHHCRVCKRCV  119 (250)
Q Consensus        92 ~~~~~~C~~C~~~kp~Rs~HC~~C~~CV  119 (250)
                      ..+.++|..|+.....++|||..-|+||
T Consensus        59 p~Rs~HC~~C~~CV~~~DHHC~w~~~cI   86 (174)
T PF01529_consen   59 PPRSHHCRVCNRCVLRFDHHCPWLGNCI   86 (174)
T ss_pred             CCcceeccccccccccccccchhhcccc
Confidence            3478999999999999999999999994


No 11 
>KOG1315 consensus Predicted DHHC-type Zn-finger protein [General function prediction only]
Probab=93.62  E-value=0.11  Score=43.73  Aligned_cols=50  Identities=30%  Similarity=0.199  Sum_probs=36.2

Q ss_pred             cCCCChhHHHhHHHhcCCCccceeccCc-CCCCCCeeeccccCCccCCCCC
Q 025621          200 KHPYDLGIFENLTSVLGPNIFSWVCPSS-RHIGSGLNFRTAYHNAVGASMS  249 (250)
Q Consensus       200 ~n~yd~G~~~N~~~vfg~~~~~w~~P~~-~~~~~g~~~~~~~~~~~~~~~~  249 (250)
                      .+.|+..+-.|+...+++....|-.+.. +..++|+++..+.+...-++.+
T Consensus       248 ~~n~~~vfg~~~~~wl~P~~~s~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  298 (307)
T KOG1315|consen  248 YVNFREVFGSNLLYWLLPIDSSWGDGVSFPLRGDGLDFRTASDSKPDNSST  298 (307)
T ss_pred             eecHHHHhCCCceEEeccccCccccCccccccccCCccccccccCcccCcc
Confidence            4577778888888889887777777764 7778888887776655544443


No 12 
>KOG1311 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=93.26  E-value=0.034  Score=47.08  Aligned_cols=27  Identities=22%  Similarity=0.525  Sum_probs=25.6

Q ss_pred             CCcccccccccccCCCCCCCcchhhhh
Q 025621           93 GDLRYCQKCSHYKPPRAHHCRVCKRCV  119 (250)
Q Consensus        93 ~~~~~C~~C~~~kp~Rs~HC~~C~~CV  119 (250)
                      .+.++|..|+.....++|||+.-|+||
T Consensus       125 pRs~HCsvC~~CV~rfDHHC~WvnnCV  151 (299)
T KOG1311|consen  125 PRSSHCSVCNNCVLRFDHHCPWLNNCI  151 (299)
T ss_pred             CCcccchhhcccccccCCCCCCccceE
Confidence            478999999999999999999999997


No 13 
>KOG1314 consensus DHHC-type Zn-finger protein [General function prediction only]
Probab=93.04  E-value=0.088  Score=44.55  Aligned_cols=62  Identities=19%  Similarity=0.211  Sum_probs=39.2

Q ss_pred             HHHhHHHhcCCCCCCCCCCCCCcCCCCcchhhhhcCCCcccccccccccCCCCCCCcchhhhh
Q 025621           57 FSYTVAILRDPGRVPADYMPDVEDDQNPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCV  119 (250)
Q Consensus        57 ~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV  119 (250)
                      ..+.---+..||.-|.....+.--+. ...-..=+..+..+|.+|+..+-...|||+.-|.||
T Consensus        68 A~~~gPG~vp~~wkPe~~~D~~~lqf-Ck~CqgYKapRSHHCrkCnrCvmkMDHHCPWinnCV  129 (414)
T KOG1314|consen   68 AIFTGPGFVPLGWKPENPKDEMFLQF-CKKCQGYKAPRSHHCRKCNRCVMKMDHHCPWINNCV  129 (414)
T ss_pred             HHhcCCCCCCCCCCCCCChhHHHHHH-HhhccCcCCCccccchHHHHHHHhhccCCcchhhcc
Confidence            33455568889998865322121110 000000011267999999999999999999999997


No 14 
>PF13240 zinc_ribbon_2:  zinc-ribbon domain
Probab=91.81  E-value=0.091  Score=26.11  Aligned_cols=21  Identities=29%  Similarity=0.733  Sum_probs=18.5

Q ss_pred             cccccccccCCCCCCCcchhh
Q 025621           97 YCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        97 ~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      +|..|....++.++.|+.||.
T Consensus         1 ~Cp~CG~~~~~~~~fC~~CG~   21 (23)
T PF13240_consen    1 YCPNCGAEIEDDAKFCPNCGT   21 (23)
T ss_pred             CCcccCCCCCCcCcchhhhCC
Confidence            689999999999999999874


No 15 
>PF10571 UPF0547:  Uncharacterised protein family UPF0547;  InterPro: IPR018886  This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines. Several members are annotated as putative helicases. 
Probab=89.13  E-value=0.19  Score=25.77  Aligned_cols=22  Identities=27%  Similarity=0.712  Sum_probs=19.5

Q ss_pred             ccccccccccCCCCCCCcchhh
Q 025621           96 RYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      +.|..|....|.-++-|+.||-
T Consensus         1 K~CP~C~~~V~~~~~~Cp~CG~   22 (26)
T PF10571_consen    1 KTCPECGAEVPESAKFCPHCGY   22 (26)
T ss_pred             CcCCCCcCCchhhcCcCCCCCC
Confidence            4699999999999999999973


No 16 
>PF13248 zf-ribbon_3:  zinc-ribbon domain
Probab=88.32  E-value=0.28  Score=25.06  Aligned_cols=22  Identities=27%  Similarity=0.750  Sum_probs=19.6

Q ss_pred             ccccccccccCCCCCCCcchhh
Q 025621           96 RYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      .+|..|....++.++.|+.||.
T Consensus         3 ~~Cp~Cg~~~~~~~~fC~~CG~   24 (26)
T PF13248_consen    3 MFCPNCGAEIDPDAKFCPNCGA   24 (26)
T ss_pred             CCCcccCCcCCcccccChhhCC
Confidence            6899999988999999999984


No 17 
>KOG1313 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=87.93  E-value=0.2  Score=41.09  Aligned_cols=64  Identities=23%  Similarity=0.340  Sum_probs=40.2

Q ss_pred             HHHHHHHHHhHHHhcCCCCCCCCCCCCCcCCCCcchhhhhcCCCcccccccccccCCCCCCCcchhhhh
Q 025621           51 VALMCVFSYTVAILRDPGRVPADYMPDVEDDQNPMHEIKRKGGDLRYCQKCSHYKPPRAHHCRVCKRCV  119 (250)
Q Consensus        51 l~~~~~~~~~~~~~~dPG~~~~~~~~~~~~~~~~~~~~~~~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV  119 (250)
                      +....++.|+++..+.|=-.|     ..+.+..-..-...+..+...|..|+...-..+|||+.-|+||
T Consensus        77 ~l~nvi~hy~ka~t~pPvgn~-----~~~~~SfC~KC~~pK~prTHHCsiC~kCVL~MDHHCPwinnCV  140 (309)
T KOG1313|consen   77 LLSNVIFHYYKARTKPPVGNP-----GLENDSFCNKCNYPKSPRTHHCSICNKCVLKMDHHCPWINNCV  140 (309)
T ss_pred             HHHHHHHhheeecccCCcCCC-----CCccccHHhhcCCCCCCCcchhhHHhhHhhccccCCchhhccc
Confidence            344456667777766651111     1111111111123334477999999999999999999999998


No 18 
>PRK04136 rpl40e 50S ribosomal protein L40e; Provisional
Probab=86.32  E-value=0.36  Score=28.46  Aligned_cols=24  Identities=33%  Similarity=0.819  Sum_probs=21.9

Q ss_pred             CcccccccccccCCCCCCCcchhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      ....|..|...-|+|+..|+.||.
T Consensus        13 ~k~ICrkC~ARnp~~A~~CRKCg~   36 (48)
T PRK04136         13 NKKICMRCNARNPWRATKCRKCGY   36 (48)
T ss_pred             cccchhcccCCCCccccccccCCC
Confidence            568999999999999999998874


No 19 
>PF07010 Endomucin:  Endomucin;  InterPro: IPR010740 This family consists of several mammalian endomucin proteins. Endomucin is an early endothelial-specific antigen that is also expressed on putative hematopoietic progenitor cells.
Probab=85.00  E-value=2.3  Score=33.97  Aligned_cols=38  Identities=24%  Similarity=0.212  Sum_probs=26.9

Q ss_pred             HHHHHHHHHHHHHHHHHhHHHhcCCCCCCCCCCCCCcC
Q 025621           43 MNAIVFTAVALMCVFSYTVAILRDPGRVPADYMPDVED   80 (250)
Q Consensus        43 ~~~ii~~~l~~~~~~~~~~~~~~dPG~~~~~~~~~~~~   80 (250)
                      +.++++.++.+..+.+|.+|..+|||.........+.+
T Consensus       195 IaliVitl~vf~LvgLyr~C~k~dPg~p~~g~~qpqsd  232 (259)
T PF07010_consen  195 IALIVITLSVFTLVGLYRMCWKTDPGTPENGPDQPQSD  232 (259)
T ss_pred             HHHHHHHHHHHHHHHHHHHhhcCCCCCcccCCCCCCcc
Confidence            45566677777888889999999999766554333333


No 20 
>KOG0509 consensus Ankyrin repeat and DHHC-type Zn-finger domain containing proteins [General function prediction only]
Probab=84.12  E-value=0.35  Score=44.14  Aligned_cols=29  Identities=28%  Similarity=0.518  Sum_probs=25.9

Q ss_pred             cCCCcccccccccccCCCCCCCcchhhhh
Q 025621           91 KGGDLRYCQKCSHYKPPRAHHCRVCKRCV  119 (250)
Q Consensus        91 ~~~~~~~C~~C~~~kp~Rs~HC~~C~~CV  119 (250)
                      +..+.++|..|+...---.|||+.-++||
T Consensus       430 Kp~rSkhc~vcnrcVarfDHhCPwi~ncV  458 (600)
T KOG0509|consen  430 KPLRSKHCSVCNRCVARFDHHCPWIGNCV  458 (600)
T ss_pred             cCCccchhhhhHHHHhccccCCCcccccc
Confidence            34578999999999999999999999997


No 21 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=83.88  E-value=28  Score=31.07  Aligned_cols=29  Identities=24%  Similarity=0.463  Sum_probs=24.5

Q ss_pred             CcccccccccccCCCCCCCcchhhhhhhH
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      ....|+.|+...+....||+.||.-..+.
T Consensus       220 ~l~~C~~Cd~l~~~~~a~CpRC~~~L~~~  248 (419)
T PRK15103        220 GLRSCSCCTAILPADQPVCPRCHTKGYVR  248 (419)
T ss_pred             CCCcCCCCCCCCCCCCCCCCCCCCcCcCC
Confidence            45679999999888888999999888666


No 22 
>PTZ00303 phosphatidylinositol kinase; Provisional
Probab=79.59  E-value=0.83  Score=43.00  Aligned_cols=22  Identities=41%  Similarity=0.848  Sum_probs=18.2

Q ss_pred             ccccccccccC-------CCCCCCcchhh
Q 025621           96 RYCQKCSHYKP-------PRAHHCRVCKR  117 (250)
Q Consensus        96 ~~C~~C~~~kp-------~Rs~HC~~C~~  117 (250)
                      ..|..|+..-.       .|-|||+.||+
T Consensus       461 dtC~~C~kkFfSlsK~L~~RKHHCRkCGr  489 (1374)
T PTZ00303        461 DSCPSCGRAFISLSRPLGTRAHHCRSCGI  489 (1374)
T ss_pred             CcccCcCCcccccccccccccccccCCcc
Confidence            57999997764       48999999877


No 23 
>PHA02680 ORF090 IMV phosphorylated membrane protein; Provisional
Probab=77.41  E-value=12  Score=25.18  Aligned_cols=27  Identities=19%  Similarity=0.169  Sum_probs=19.5

Q ss_pred             HHHHHHHHHHHHHHhccCcchHHHHhh
Q 025621          159 SVALSVLLGWHIYLIFHNKTTIEYHEG  185 (250)
Q Consensus       159 ~~~~~~ll~~~~~li~~n~TT~E~~~~  185 (250)
                      .+.+.+++++.+|--+++.++.|++++
T Consensus        57 ~vl~lGilifs~y~~C~~~~~~~r~n~   83 (91)
T PHA02680         57 AVLLLGLFVFSMYRKCSGSMPYERLNN   83 (91)
T ss_pred             HHHHHHHHHHHHhcccCCCceeecccC
Confidence            334445888888878888888887764


No 24 
>KOG1312 consensus DHHC-type Zn-finger proteins [General function prediction only]
Probab=77.08  E-value=0.51  Score=39.02  Aligned_cols=30  Identities=20%  Similarity=0.452  Sum_probs=28.1

Q ss_pred             CCcccccccccccCCCCCCCcchhhhhhhH
Q 025621           93 GDLRYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        93 ~~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      .+.++|+.|+..+-.-.|||-.-|+||...
T Consensus       160 ARSKHCsiCNrCV~rfDHHCiWiNNCIG~~  189 (341)
T KOG1312|consen  160 ARSKHCSICNRCVHRFDHHCIWINNCIGAW  189 (341)
T ss_pred             cccccchHHHHHHHHhccceEeeecccccc
Confidence            477999999999999999999999999987


No 25 
>COG2093 DNA-directed RNA polymerase, subunit E'' [Transcription]
Probab=75.14  E-value=1.4  Score=27.52  Aligned_cols=23  Identities=26%  Similarity=0.777  Sum_probs=20.8

Q ss_pred             cccccccccccCCCCCCCcchhh
Q 025621           95 LRYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        95 ~~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      .+-|..|+...|+.+.-|+.||.
T Consensus         4 ~kAC~~Ck~l~~~d~e~CP~Cgs   26 (64)
T COG2093           4 EKACKNCKRLTPEDTEICPVCGS   26 (64)
T ss_pred             hHHHhhccccCCCCCccCCCCCC
Confidence            46799999999999999999985


No 26 
>COG1552 RPL40A Ribosomal protein L40E [Translation, ribosomal structure and biogenesis]
Probab=73.77  E-value=0.73  Score=27.23  Aligned_cols=24  Identities=38%  Similarity=0.989  Sum_probs=21.3

Q ss_pred             CcccccccccccCCCCCCCcchhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      ..+.|..|...-|+++.-|+.|+.
T Consensus        13 ~kkIC~rC~Arnp~~A~kCRkC~~   36 (50)
T COG1552          13 NKKICRRCYARNPPRATKCRKCGY   36 (50)
T ss_pred             hHHHHHHhcCCCCcchhHHhhccC
Confidence            458999999999999999998863


No 27 
>PF12773 DZR:  Double zinc ribbon
Probab=71.43  E-value=3  Score=24.76  Aligned_cols=23  Identities=30%  Similarity=0.853  Sum_probs=18.2

Q ss_pred             CcccccccccccCCCCCCCcchh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCK  116 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~  116 (250)
                      ...+|..|....++.++.|..||
T Consensus        28 ~~~~C~~Cg~~~~~~~~fC~~CG   50 (50)
T PF12773_consen   28 SKKICPNCGAENPPNAKFCPNCG   50 (50)
T ss_pred             CCCCCcCCcCCCcCCcCccCccc
Confidence            45788888888888888888775


No 28 
>PF00641 zf-RanBP:  Zn-finger in Ran binding protein and others;  InterPro: IPR001876 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  This entry represents the zinc finger domain found in RanBP2 proteins. Ran is an evolutionary conserved member of the Ras superfamily that regulates all receptor-mediated transport between the nucleus and the cytoplasm. Ran binding protein 2 (RanBP2) is a 358kDa nucleoporin located on the cytoplasmic side of the nuclear pore complex which plays a role in nuclear protein import []. RanBP2 contains multiple zinc fingers which mediate binding to RanGDP []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0005622 intracellular; PDB: 2D9G_A 2EBR_A 2WX0_C 2WX1_C 2WWZ_C 3GJ6_B 2LK0_A 2LK1_A 3GJ5_B 3GJ8_B ....
Probab=69.03  E-value=1.7  Score=22.83  Aligned_cols=20  Identities=25%  Similarity=0.838  Sum_probs=12.5

Q ss_pred             cccccccccCCCCCCCcchh
Q 025621           97 YCQKCSHYKPPRAHHCRVCK  116 (250)
Q Consensus        97 ~C~~C~~~kp~Rs~HC~~C~  116 (250)
                      .|..|...-+.++.||..|+
T Consensus         6 ~C~~C~~~N~~~~~~C~~C~   25 (30)
T PF00641_consen    6 KCPSCTFMNPASRSKCVACG   25 (30)
T ss_dssp             EETTTTEEEESSSSB-TTT-
T ss_pred             cCCCCcCCchHHhhhhhCcC
Confidence            46777777777777777665


No 29 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=68.67  E-value=43  Score=29.73  Aligned_cols=29  Identities=24%  Similarity=0.553  Sum_probs=22.4

Q ss_pred             Cccccccccc-ccCCCCCCCcchhhhhhhH
Q 025621           94 DLRYCQKCSH-YKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        94 ~~~~C~~C~~-~kp~Rs~HC~~C~~CV~~~  122 (250)
                      ...-|+.|+. ..+....||+.||.-..+.
T Consensus       214 ~~~~C~~Cd~~~~~~~~a~CpRC~~~L~~~  243 (403)
T TIGR00155       214 KLRSCSACHTTILPAQEPVCPRCSTPLYVR  243 (403)
T ss_pred             CCCcCCCCCCccCCCCCcCCcCCCCcccCC
Confidence            4566999998 4566667999999887666


No 30 
>PF01363 FYVE:  FYVE zinc finger;  InterPro: IPR000306 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The FYVE zinc finger is named after four proteins that it has been found in: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two zinc ions []. The FYVE finger has eight potential zinc coordinating cysteine positions. Many members of this family also include two histidines in a motif R+HHC+XCG, where + represents a charged residue and X any residue. FYVE-type domains are divided into two known classes: FYVE domains that specifically bind to phosphatidylinositol 3-phosphate in lipid bilayers and FYVE-related domains of undetermined function []. Those that bind to phosphatidylinositol 3-phosphate are often found in proteins targeted to lipid membranes that are involved in regulating membrane traffic [, , ]. Most FYVE domains target proteins to endosomes by binding specifically to phosphatidylinositol-3-phosphate at the membrane surface. By contrast, the CARP2 FYVE-like domain is not optimized to bind to phosphoinositides or insert into lipid bilayers. FYVE domains are distinguished from other zinc fingers by three signature sequences: an N-terminal WxxD motif, a basic R(R/K)HHCR patch, and a C-terminal RVC motif. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0046872 metal ion binding; PDB: 1HYI_A 1JOC_B 1HYJ_A 1DVP_A 3ZYQ_A 4AVX_A 1VFY_A 3T7L_A 1X4U_A 1WFK_A ....
Probab=67.16  E-value=1.5  Score=28.02  Aligned_cols=26  Identities=38%  Similarity=0.775  Sum_probs=12.4

Q ss_pred             Ccccccccccc--cCCCCCCCcchhhhh
Q 025621           94 DLRYCQKCSHY--KPPRAHHCRVCKRCV  119 (250)
Q Consensus        94 ~~~~C~~C~~~--kp~Rs~HC~~C~~CV  119 (250)
                      ....|..|...  --.|-|||+.||+-|
T Consensus         8 ~~~~C~~C~~~F~~~~rrhhCr~CG~~v   35 (69)
T PF01363_consen    8 EASNCMICGKKFSLFRRRHHCRNCGRVV   35 (69)
T ss_dssp             G-SB-TTT--B-BSSS-EEE-TTT--EE
T ss_pred             CCCcCcCcCCcCCCceeeEccCCCCCEE
Confidence            34677777744  347888999998743


No 31 
>KOG1842 consensus FYVE finger-containing protein [General function prediction only]
Probab=66.29  E-value=1.4  Score=38.64  Aligned_cols=29  Identities=34%  Similarity=0.935  Sum_probs=23.0

Q ss_pred             Ccccccccccc--cCCCCCCCcchhhhhhhH
Q 025621           94 DLRYCQKCSHY--KPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        94 ~~~~C~~C~~~--kp~Rs~HC~~C~~CV~~~  122 (250)
                      .-.+|+.|...  -..|-|||+.||+-+=+.
T Consensus       179 ~V~~CP~Ca~~F~l~rRrHHCRLCG~VmC~~  209 (505)
T KOG1842|consen  179 SVQFCPECANSFGLTRRRHHCRLCGRVMCRD  209 (505)
T ss_pred             cccccccccchhhhHHHhhhhhhcchHHHHH
Confidence            56899999855  456899999999865555


No 32 
>PF14127 DUF4294:  Domain of unknown function (DUF4294)
Probab=65.75  E-value=5.9  Score=30.00  Aligned_cols=33  Identities=9%  Similarity=0.099  Sum_probs=28.2

Q ss_pred             hccCcchHHHHhhhhHHHHHHhCCCcccCCCChhHHHhHHHhcCCC
Q 025621          173 IFHNKTTIEYHEGVRALWLAEKGGTVYKHPYDLGIFENLTSVLGPN  218 (250)
Q Consensus       173 i~~n~TT~E~~~~~~~~~~~~~~~~~~~n~yd~G~~~N~~~vfg~~  218 (250)
                      --+|.|++|.++.             ..++|..|+++..+.+||-+
T Consensus       102 Retg~TsyelIK~-------------~rgg~~A~~~q~~A~~Fg~s  134 (157)
T PF14127_consen  102 RETGSTSYELIKE-------------LRGGWRAFWYQTFAWLFGIS  134 (157)
T ss_pred             HhcCCcHHHHHHH-------------hhCChhHHHHHHHHHHhCcc
Confidence            4479999999986             56788889999999999964


No 33 
>PF09889 DUF2116:  Uncharacterized protein containing a Zn-ribbon (DUF2116);  InterPro: IPR019216 This entry contains various hypothetical prokaryotic proteins whose functions are unknown. They contain a conserved zinc ribbon motif in the N-terminal part and a predicted transmembrane segment in the C-terminal part.
Probab=65.11  E-value=11  Score=23.46  Aligned_cols=23  Identities=26%  Similarity=0.787  Sum_probs=17.9

Q ss_pred             cccccccccccCCCCCCCc-chhh
Q 025621           95 LRYCQKCSHYKPPRAHHCR-VCKR  117 (250)
Q Consensus        95 ~~~C~~C~~~kp~Rs~HC~-~C~~  117 (250)
                      -+.|..|....|+.-.-|| .|..
T Consensus         3 HkHC~~CG~~Ip~~~~fCS~~C~~   26 (59)
T PF09889_consen    3 HKHCPVCGKPIPPDESFCSPKCRE   26 (59)
T ss_pred             CCcCCcCCCcCCcchhhhCHHHHH
Confidence            4789999988888888885 5654


No 34 
>smart00064 FYVE Protein present in Fab1, YOTB, Vac1, and EEA1. The FYVE zinc finger is named after four proteins where it was first found: Fab1, YOTB/ZK632.12, Vac1, and EEA1. The FYVE finger has been shown to bind two Zn2+ ions. The FYVE finger has eight potential zinc coordinating cysteine positions. The FYVE finger is structurally related to the PF01020 Ribosomal_L40e:  Ribosomal L40e family;  InterPro: IPR001975 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms. The codons of the mRNA are exposed on the ribosome to allow tRNA binding. This leads to the incorporation of amino acids into the growing polypeptide chain in accordance with the genetic information. Incoming amino acid monomers enter the ribosomal A site in the form of aminoacyl-tRNAs complexed with elongation factor Tu (EF-Tu) and GTP. The growing polypeptide chain, situated in the P site as peptidyl-tRNA, is then transferred to aminoacyl-tRNA and the new peptidyl-tRNA, extended by one residue, is translocated to the P site with the aid the elongation factor G (EF-G) and GTP as the deacylated tRNA is released from the ribosome through one or more exit sites [, ]. About 2/3 of the mass of the ribosome consists of RNA and 1/3 of protein. The proteins are named in accordance with the subunit of the ribosome which they belong to - the small (S1 to S31) and the large (L1 to L44). Usually they decorate the rRNA cores of the subunits.  Many ribosomal proteins, particularly those of the large subunit, are composed of a globular, surfaced-exposed domain with long finger-like projections that extend into the rRNA core to stabilise its structure. Most of the proteins interact with multiple RNA elements, often from different domains. In the large subunit, about 1/3 of the 23S rRNA nucleotides are at least in van der Waal's contact with protein, and L22 interacts with all six domains of the 23S rRNA. Proteins S4 and S7, which initiate assembly of the 16S rRNA, are located at junctions of five and four RNA helices, respectively. In this way proteins serve to organise and stabilise the rRNA tertiary structure. While the crucial activities of decoding and peptide transfer are RNA based, proteins play an active role in functions that may have evolved to streamline the process of protein synthesis. In addition to their function in the ribosome, many ribosomal proteins have some function 'outside' the ribosome [, ]. This family contains the L40 ribosomal protein from both archaea and eukaryotes. Bovine ribosomal protein L40 has been identified as a secondary RNA binding protein []. L40 is fused to a ubiquitin protein [].; GO: 0003735 structural constituent of ribosome, 0006412 translation, 0005840 ribosome; PDB: 3IZS_p 3IZR_p 2AYJ_A 4A1B_K 4A19_K 4A18_K 4A1D_K.
Probab=59.72  E-value=4.5  Score=24.32  Aligned_cols=25  Identities=44%  Similarity=0.934  Sum_probs=17.4

Q ss_pred             CcccccccccccCCCCCCCcc--hhhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRV--CKRC  118 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~--C~~C  118 (250)
                      ....|..|...-|+|+..|+.  ||.+
T Consensus        16 ~k~ICrkCyarl~~~A~nCRKkkCGhs   42 (52)
T PF01020_consen   16 DKMICRKCYARLPPRATNCRKKKCGHS   42 (52)
T ss_dssp             S-EEETTT--EE-TTSSS-TSSSCTS-
T ss_pred             cceecccccCcCCCCccceecccCCCC
Confidence            568999999999999999998  8765


No 36 
>cd00065 FYVE FYVE domain; Zinc-binding domain; targets proteins to membrane lipids via interaction with phosphatidylinositol-3-phosphate, PI3P; present in Fab1, YOTB, Vac1, and EEA1;
Probab=55.23  E-value=7.3  Score=23.63  Aligned_cols=23  Identities=39%  Similarity=0.839  Sum_probs=14.2

Q ss_pred             ccccccccc--cCCCCCCCcchhhh
Q 025621           96 RYCQKCSHY--KPPRAHHCRVCKRC  118 (250)
Q Consensus        96 ~~C~~C~~~--kp~Rs~HC~~C~~C  118 (250)
                      +.|..|+..  .-.|.|||+.||+-
T Consensus         3 ~~C~~C~~~F~~~~rk~~Cr~Cg~~   27 (57)
T cd00065           3 SSCMGCGKPFTLTRRRHHCRNCGRI   27 (57)
T ss_pred             CcCcccCccccCCccccccCcCcCC
Confidence            345556532  35677888888763


No 37 
>PRK02251 putative septation inhibitor protein; Reviewed
Probab=54.84  E-value=64  Score=21.85  Aligned_cols=32  Identities=13%  Similarity=0.063  Sum_probs=20.1

Q ss_pred             CcccchhHHHHHHHHHHHHHHHHHhhhccccc
Q 025621            4 GFTFSLPVSVVVLAIFYIYFTTVFIFIDRWFG   35 (250)
Q Consensus         4 ~~~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~   35 (250)
                      +...|..++.+.++++.+.+..++++...-++
T Consensus        29 ~sP~W~~~~m~~lm~~Gl~WlvvyYl~~~~~P   60 (87)
T PRK02251         29 SNPRWFVPLFVALMIIGLIWLVVYYLSNGSLP   60 (87)
T ss_pred             CCCchHHHHHHHHHHHHHHHHHHHhhhCCCcC
Confidence            45667777777776666666666666543333


No 38 
>cd01995 ExsB ExsB is a transcription regulator related protein. It is a subfamily of a Adenosine nucleotide binding superfamily of proteins. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown
Probab=54.30  E-value=7.1  Score=29.72  Aligned_cols=26  Identities=31%  Similarity=0.692  Sum_probs=19.6

Q ss_pred             CcccccccccccCCCCCCCcchhhhhhhH
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      ......+|...   ..+||..|..|+.|+
T Consensus       139 ~~~~s~sC~~~---~~~~CG~C~~C~~r~  164 (169)
T cd01995         139 PLELTWSCYNG---GEKHCGECDSCLLRK  164 (169)
T ss_pred             ChhheeeccCC---CCCCCCCCHHHHHHH
Confidence            44556677665   338999999999986


No 39 
>PF08113 CoxIIa:  Cytochrome c oxidase subunit IIa family;  InterPro: IPR012538 This family consists of the cytochrome c oxidase subunit IIa family. The bax-type cytochrome c oxidase from Thermus thermophilus is known as a two subunit enzyme. From its crystal structure, it was discovered that an additional transmembrane helix, subunit IIa, spans the membrane. This subunit consists of 34 residues forming one helix across the membrane. The presence of this subunit seems to be important for the function of cytochrome c oxidases [].; PDB: 2QPD_C 3QJR_C 3EH5_C 3BVD_C 3S39_C 3QJU_C 3QJS_C 4EV3_C 3QJT_C 4FA7_C ....
Probab=53.84  E-value=26  Score=18.96  Aligned_cols=23  Identities=17%  Similarity=0.330  Sum_probs=8.8

Q ss_pred             CCCCcccchhHHHHHHHHHHHHH
Q 025621            1 MTKGFTFSLPVSVVVLAIFYIYF   23 (250)
Q Consensus         1 ~~~~~~~~~p~~~~~~l~~~~~~   23 (250)
                      |+.|.-+-+-++.++.+.+.+++
T Consensus         1 meekp~Gal~vv~iLt~~ILvFW   23 (34)
T PF08113_consen    1 MEEKPKGALGVVMILTAFILVFW   23 (34)
T ss_dssp             ---STHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCcceeeeHHHHHHHHHHHH
Confidence            44554444444444444333333


No 40 
>COG4640 Predicted membrane protein [Function unknown]
Probab=53.14  E-value=28  Score=30.50  Aligned_cols=28  Identities=21%  Similarity=0.615  Sum_probs=24.4

Q ss_pred             cccccccccccCCCCCCCcchhhhhhhH
Q 025621           95 LRYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        95 ~~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      +++|..|...+-+.+..|..||.=+..+
T Consensus         1 M~fC~kcG~qk~Ed~~qC~qCG~~~t~~   28 (465)
T COG4640           1 MKFCPKCGSQKAEDDVQCTQCGHKFTSR   28 (465)
T ss_pred             CCcccccccccccccccccccCCcCCch
Confidence            3789999999999999999999877765


No 41 
>KOG1841 consensus Smad anchor for receptor activation [Defense mechanisms]
Probab=53.13  E-value=7.2  Score=38.50  Aligned_cols=23  Identities=35%  Similarity=0.820  Sum_probs=17.2

Q ss_pred             cccccccc--cccCCCCCCCcchhh
Q 025621           95 LRYCQKCS--HYKPPRAHHCRVCKR  117 (250)
Q Consensus        95 ~~~C~~C~--~~kp~Rs~HC~~C~~  117 (250)
                      ..-|..|.  -.--.|-|||+.||+
T Consensus       557 ~pncm~clqkft~ikrrhhcRacgk  581 (1287)
T KOG1841|consen  557 APNCMDCLQKFTPIKRRHHCRACGK  581 (1287)
T ss_pred             CchHHHHHhhcccccccccchhccc
Confidence            45566666  445678999999997


No 42 
>PRK03681 hypA hydrogenase nickel incorporation protein; Validated
Probab=52.48  E-value=6.6  Score=28.11  Aligned_cols=24  Identities=21%  Similarity=0.685  Sum_probs=18.8

Q ss_pred             CcccccccccccCCCCCC---Ccchhh
Q 025621           94 DLRYCQKCSHYKPPRAHH---CRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~H---C~~C~~  117 (250)
                      ..-+|..|+..-|...++   |+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~~CP~Cgs   95 (114)
T PRK03681         69 AECWCETCQQYVTLLTQRVRRCPQCHG   95 (114)
T ss_pred             cEEEcccCCCeeecCCccCCcCcCcCC
Confidence            458999999888776555   999884


No 43 
>KOG1819 consensus FYVE finger-containing proteins [General function prediction only]
Probab=51.46  E-value=4.4  Score=36.34  Aligned_cols=24  Identities=38%  Similarity=0.750  Sum_probs=17.5

Q ss_pred             Ccccccccccc--cCCCCCCCcchhh
Q 025621           94 DLRYCQKCSHY--KPPRAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~--kp~Rs~HC~~C~~  117 (250)
                      ....|..|+..  .--|-|||+-||.
T Consensus       900 ~a~~cmacq~pf~afrrrhhcrncgg  925 (990)
T KOG1819|consen  900 DAEQCMACQMPFNAFRRRHHCRNCGG  925 (990)
T ss_pred             cchhhhhccCcHHHHHHhhhhcccCc
Confidence            44678888865  3457899998875


No 44 
>PF06781 UPF0233:  Uncharacterised protein family (UPF0233);  InterPro: IPR009619 This is a group of proteins of unknown function.
Probab=50.39  E-value=78  Score=21.47  Aligned_cols=30  Identities=10%  Similarity=0.057  Sum_probs=19.5

Q ss_pred             CCcccchhHHHHHHHHHHHHHHHHHhhhcc
Q 025621            3 KGFTFSLPVSVVVLAIFYIYFTTVFIFIDR   32 (250)
Q Consensus         3 ~~~~~~~p~~~~~~l~~~~~~~~~~~~~~~   32 (250)
                      +++..|..++.+.++++.+.+..++++...
T Consensus        27 ~~sp~W~~p~m~~lmllGL~WiVvyYi~~~   56 (87)
T PF06781_consen   27 KPSPRWYAPLMLGLMLLGLLWIVVYYISGG   56 (87)
T ss_pred             CCCCccHHHHHHHHHHHHHHHHhhhhcccC
Confidence            345667777777676666666666666654


No 45 
>PF07649 C1_3:  C1-like domain;  InterPro: IPR011424 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in IPR002219 from INTERPRO. C1 domains are protein kinase C-like zinc finger structures. Diacylglycerol (DAG) kinases (DGKs) have a two or three commonly conserved cysteine-rich C1 domains []. DGKs modulate the balance between the two signaling lipids, DAG and phosphatidic acid (PA), by phosphorylating DAG to yield PA []. The PKD (protein kinase D) family are novel DAG receptors. They have twin C1 domains, designated C1a and C1b, which bind DAG or phorbol esters. Individual C1 domains differ in ligand-binding activity and selectivity []. ; GO: 0047134 protein-disulfide reductase activity, 0055114 oxidation-reduction process; PDB: 1V5N_A.
Probab=49.39  E-value=4.2  Score=21.33  Aligned_cols=21  Identities=19%  Similarity=0.444  Sum_probs=7.7

Q ss_pred             cccccccccCC-CCCCCcchhh
Q 025621           97 YCQKCSHYKPP-RAHHCRVCKR  117 (250)
Q Consensus        97 ~C~~C~~~kp~-Rs~HC~~C~~  117 (250)
                      .|..|+..... ...||..|+-
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~Cdf   23 (30)
T PF07649_consen    2 RCDACGKPIDGGWFYRCSECDF   23 (30)
T ss_dssp             --TTTS----S--EEE-TTT--
T ss_pred             cCCcCCCcCCCCceEECccCCC
Confidence            46667766655 6667777763


No 46 
>PF07282 OrfB_Zn_ribbon:  Putative transposase DNA-binding domain;  InterPro: IPR010095 This entry represents a region of a sequence similarity between a family of putative transposases of Thermoanaerobacter tengcongensis, smaller related proteins from Bacillus anthracis, putative transposes described by IPR001959 from INTERPRO, and other proteins. More information about these proteins can be found at Protein of the Month: Transposase [].
Probab=48.55  E-value=8.1  Score=24.60  Aligned_cols=27  Identities=22%  Similarity=0.504  Sum_probs=20.1

Q ss_pred             CcccccccccccC----CCCCCCcchhhhhh
Q 025621           94 DLRYCQKCSHYKP----PRAHHCRVCKRCVL  120 (250)
Q Consensus        94 ~~~~C~~C~~~kp----~Rs~HC~~C~~CV~  120 (250)
                      ..+.|+.|.....    .|.++|+.||.-..
T Consensus        27 TSq~C~~CG~~~~~~~~~r~~~C~~Cg~~~~   57 (69)
T PF07282_consen   27 TSQTCPRCGHRNKKRRSGRVFTCPNCGFEMD   57 (69)
T ss_pred             CccCccCcccccccccccceEEcCCCCCEEC
Confidence            5688999997654    47778998886443


No 47 
>KOG1818 consensus Membrane trafficking and cell signaling protein HRS, contains VHS and FYVE domains [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport]
Probab=47.72  E-value=7.7  Score=36.07  Aligned_cols=24  Identities=38%  Similarity=0.825  Sum_probs=19.0

Q ss_pred             Ccccccccccc--cCCCCCCCcchhh
Q 025621           94 DLRYCQKCSHY--KPPRAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~--kp~Rs~HC~~C~~  117 (250)
                      ...-|..|...  --.|.|||+.||+
T Consensus       164 D~~~C~rCr~~F~~~~rkHHCr~CG~  189 (634)
T KOG1818|consen  164 DSEECLRCRVKFGLTNRKHHCRNCGQ  189 (634)
T ss_pred             cccccceeeeeeeeccccccccccch
Confidence            45788888854  3459999999998


No 48 
>PF02150 RNA_POL_M_15KD:  RNA polymerases M/15 Kd subunit;  InterPro: IPR001529 DNA-directed RNA polymerases 2.7.7.6 from EC (also known as DNA-dependent RNA polymerases) are responsible for the polymerisation of ribonucleotides into a sequence complementary to the template DNA. In eukaryotes, there are three different forms of DNA-directed RNA polymerases transcribing different sets of genes. Most RNA polymerases are multimeric enzymes and are composed of a variable number of subunits. The core RNA polymerase complex consists of five subunits (two alpha, one beta, one beta-prime and one omega) and is sufficient for transcription elongation and termination but is unable to initiate transcription. Transcription initiation from promoter elements requires a sixth, dissociable subunit called a sigma factor, which reversibly associates with the core RNA polymerase complex to form a holoenzyme []. The core RNA polymerase complex forms a "crab claw"-like structure with an internal channel running along the full length []. The key functional sites of the enzyme, as defined by mutational and cross-linking analysis, are located on the inner wall of this channel. RNA synthesis follows after the attachment of RNA polymerase to a specific site, the promoter, on the template DNA strand. The RNA synthesis process continues until a termination sequence is reached. The RNA product, which is synthesised in the 5' to 3'direction, is known as the primary transcript. Eukaryotic nuclei contain three distinct types of RNA polymerases that differ in the RNA they synthesise:  RNA polymerase I: located in the nucleoli, synthesises precursors of most ribosomal RNAs. RNA polymerase II: occurs in the nucleoplasm, synthesises mRNA precursors.  RNA polymerase III: also occurs in the nucleoplasm, synthesises the precursors of 5S ribosomal RNA, the tRNAs, and a variety of other small nuclear and cytosolic RNAs.   Eukaryotic cells are also known to contain separate mitochondrial and chloroplast RNA polymerases. Eukaryotic RNA polymerases, whose molecular masses vary in size from 500 to 700 kDa, contain two non-identical large (>100 kDa) subunits and an array of up to 12 different small (less than 50 kDa) subunits. In archaebacteria, there is generally a single form of RNA polymerase which also consist of an oligomeric assemblage of 10 to 13 polypeptides. It has recently been shown [], [] that small subunits of about 15 kDa, found in polymerase types I and II, are highly conserved. These proteins contain a probable zinc finger in their N-terminal region and a C-terminal zinc ribbon domain (see IPR001222 from INTERPRO).; GO: 0003677 DNA binding, 0003899 DNA-directed RNA polymerase activity, 0006351 transcription, DNA-dependent; PDB: 3H0G_I 3M4O_I 3S14_I 2E2J_I 4A3J_I 3HOZ_I 1TWA_I 3S1Q_I 3S1N_I 1TWG_I ....
Probab=45.76  E-value=5.4  Score=21.95  Aligned_cols=7  Identities=43%  Similarity=1.626  Sum_probs=3.4

Q ss_pred             ccccccc
Q 025621           96 RYCQKCS  102 (250)
Q Consensus        96 ~~C~~C~  102 (250)
                      ++|..|.
T Consensus         2 ~FCp~C~    8 (35)
T PF02150_consen    2 RFCPECG    8 (35)
T ss_dssp             -BETTTT
T ss_pred             eeCCCCC
Confidence            4555555


No 49 
>PRK00432 30S ribosomal protein S27ae; Validated
Probab=44.88  E-value=9.9  Score=22.80  Aligned_cols=23  Identities=22%  Similarity=0.832  Sum_probs=15.0

Q ss_pred             Cccccccccc-c--cCCCCCCCcchh
Q 025621           94 DLRYCQKCSH-Y--KPPRAHHCRVCK  116 (250)
Q Consensus        94 ~~~~C~~C~~-~--kp~Rs~HC~~C~  116 (250)
                      ..++|+.|.. .  .-....||..|+
T Consensus        19 ~~~fCP~Cg~~~m~~~~~r~~C~~Cg   44 (50)
T PRK00432         19 KNKFCPRCGSGFMAEHLDRWHCGKCG   44 (50)
T ss_pred             ccCcCcCCCcchheccCCcEECCCcC
Confidence            4579999977 2  222355777776


No 50 
>PF09297 zf-NADH-PPase:  NADH pyrophosphatase zinc ribbon domain;  InterPro: IPR015376 This domain has a zinc ribbon structure and is often found between two NUDIX domains.; GO: 0016787 hydrolase activity, 0046872 metal ion binding; PDB: 1VK6_A 2GB5_A.
Probab=44.32  E-value=6.9  Score=20.86  Aligned_cols=22  Identities=27%  Similarity=0.717  Sum_probs=10.2

Q ss_pred             cccccccccc----cCCCCCCCcchh
Q 025621           95 LRYCQKCSHY----KPPRAHHCRVCK  116 (250)
Q Consensus        95 ~~~C~~C~~~----kp~Rs~HC~~C~  116 (250)
                      .+||..|...    ...++..|+.|+
T Consensus         3 ~rfC~~CG~~t~~~~~g~~r~C~~Cg   28 (32)
T PF09297_consen    3 HRFCGRCGAPTKPAPGGWARRCPSCG   28 (32)
T ss_dssp             TSB-TTT--BEEE-SSSS-EEESSSS
T ss_pred             CcccCcCCccccCCCCcCEeECCCCc
Confidence            4778888744    233455555554


No 51 
>PF03503 Chlam_OMP3:  Chlamydia cysteine-rich outer membrane protein 3;  InterPro: IPR003517 Three cysteine-rich proteins (also believed to be lipoproteins) make up the extracellular matrix of the Chlamydial outer membrane []. They are involved in the essential structural integrity of both the elementary body (EB) and recticulate body (RB) phase. As these bacteria lack the peptidoglycan layer common to most Gram-negative microbes, such proteins are highly important in the pathogenicity of the organism. The largest of these is the major outer membrane protein (MOMP), and constitutes around 60% of the total protein for the membrane []. OMP2 is the second largest, with a molecular mass of 58kDa, while the OMP3 protein is ~15kDa []. MOMP is believed to elicit the strongest immune response, and has recently been linked to heart disease through its sequence similarity to a murine heart-muscle specific alpha myosin [].  The OMP3 family plays a structural role in the outer membrane during the EB stage of the Chlamydial cell, and different biovars show a small, yet highly significant, change at peptide charge level []. Members of this family include Chlamydia trachomatis, Chlamydia pneumoniae, and Chlamydia psittaci.; GO: 0005201 extracellular matrix structural constituent
Probab=43.41  E-value=15  Score=21.63  Aligned_cols=21  Identities=24%  Similarity=0.626  Sum_probs=9.3

Q ss_pred             ccccccccccCCCCCCCcchh
Q 025621           96 RYCQKCSHYKPPRAHHCRVCK  116 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs~HC~~C~  116 (250)
                      +-|..|+..|-+++--|+.||
T Consensus        24 ~sc~pc~~~kkd~~~g~n~cg   44 (55)
T PF03503_consen   24 KSCNPCEVNKKDVSCGCNPCG   44 (55)
T ss_pred             CcccccccccccccCCccccc
Confidence            344444444444444444443


No 52 
>PRK02935 hypothetical protein; Provisional
Probab=42.11  E-value=1.2e+02  Score=21.32  Aligned_cols=8  Identities=25%  Similarity=0.924  Sum_probs=3.6

Q ss_pred             cccccccc
Q 025621           96 RYCQKCSH  103 (250)
Q Consensus        96 ~~C~~C~~  103 (250)
                      ..|..|+.
T Consensus        87 D~CM~C~~   94 (110)
T PRK02935         87 DACMHCNQ   94 (110)
T ss_pred             eecCcCCC
Confidence            34444443


No 53 
>PF05814 DUF843:  Baculovirus protein of unknown function (DUF843);  InterPro: IPR008561 This family consists of several unidentified baculovirus proteins of around 85 residues long with no known function.
Probab=41.73  E-value=1.1e+02  Score=20.55  Aligned_cols=23  Identities=17%  Similarity=0.250  Sum_probs=14.1

Q ss_pred             HHHHHHHHhccCcchHHHHhhhhH
Q 025621          165 LLGWHIYLIFHNKTTIEYHEGVRA  188 (250)
Q Consensus       165 ll~~~~~li~~n~TT~E~~~~~~~  188 (250)
                      ++..|+|.+ +.+++.+.+...+.
T Consensus        38 ~~~L~~yy~-kteS~~~dL~t~k~   60 (83)
T PF05814_consen   38 FCVLQVYYI-KTESTPQDLQTEKA   60 (83)
T ss_pred             HHHHHHHHc-CCCCcHHHHhhhhh
Confidence            455577777 66777666644333


No 54 
>smart00661 RPOL9 RNA polymerase subunit 9.
Probab=40.85  E-value=10  Score=22.46  Aligned_cols=9  Identities=33%  Similarity=0.700  Sum_probs=4.7

Q ss_pred             ccccccccc
Q 025621           96 RYCQKCSHY  104 (250)
Q Consensus        96 ~~C~~C~~~  104 (250)
                      ..|..|...
T Consensus        21 ~vC~~Cg~~   29 (52)
T smart00661       21 FVCRKCGYE   29 (52)
T ss_pred             EECCcCCCe
Confidence            455555543


No 55 
>TIGR00364 exsB protein. This protein family is represented by a single member in nearly every completed large ( 1000 genes) prokaryotic genome. In Rhizobium meliloti, a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA. In Arthrobacter viscosus, the homologous gene is designated ALU1 and is associated with an aluminum tolerance phenotype. The function is unknown.
Probab=38.32  E-value=16  Score=28.69  Aligned_cols=23  Identities=26%  Similarity=0.655  Sum_probs=15.9

Q ss_pred             ccccccccccCCCCCCCcchhhhhhh
Q 025621           96 RYCQKCSHYKPPRAHHCRVCKRCVLR  121 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs~HC~~C~~CV~~  121 (250)
                      ..=..|...   ..+||..|..|+.|
T Consensus       179 ~~t~sC~~~---~~~~CG~C~~C~~r  201 (201)
T TIGR00364       179 KLTYSCYAG---GGEGCGKCPSCMLR  201 (201)
T ss_pred             hhCCcCCCc---CCCCCCCChhhhcc
Confidence            444456554   24699999999875


No 56 
>smart00547 ZnF_RBZ Zinc finger domain. Zinc finger domain in Ran-binding proteins (RanBPs), and other proteins. In RanBPs, this domain binds RanGDP.
Probab=38.13  E-value=14  Score=18.36  Aligned_cols=20  Identities=20%  Similarity=0.614  Sum_probs=14.4

Q ss_pred             cccccccccCCCCCCCcchh
Q 025621           97 YCQKCSHYKPPRAHHCRVCK  116 (250)
Q Consensus        97 ~C~~C~~~kp~Rs~HC~~C~  116 (250)
                      .|..|......++..|..|+
T Consensus         4 ~C~~C~~~N~~~~~~C~~C~   23 (26)
T smart00547        4 ECPACTFLNFASRSKCFACG   23 (26)
T ss_pred             cCCCCCCcChhhhccccccC
Confidence            47777777777777777775


No 57 
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only]
Probab=37.30  E-value=32  Score=28.09  Aligned_cols=27  Identities=26%  Similarity=0.543  Sum_probs=19.9

Q ss_pred             Ccccccccccc----------cCCCCCCCcchhhhhh
Q 025621           94 DLRYCQKCSHY----------KPPRAHHCRVCKRCVL  120 (250)
Q Consensus        94 ~~~~C~~C~~~----------kp~Rs~HC~~C~~CV~  120 (250)
                      ..+.|.-|++.          +++.-.||+.|||-.+
T Consensus       196 ~g~~C~GC~m~l~~~~~~~V~~~d~iv~CP~CgRILy  232 (239)
T COG1579         196 EGRVCGGCHMKLPSQTLSKVRKKDEIVFCPYCGRILY  232 (239)
T ss_pred             cCCcccCCeeeecHHHHHHHhcCCCCccCCccchHHH
Confidence            44788888854          4566789999998654


No 58 
>PF04161 Arv1:  Arv1-like family ;  InterPro: IPR007290 Arv1 is a transmembrane protein, with potential zinc-binding motifs, that mediates sterol homeostasis. Its action is important in lipid homeostasis, which prevents free sterol toxicity []. Arv1 contains a homology domain (AHD), which consists of an N-terminal cysteine-rich subdomain with a putative zinc-binding motif, followed by a C-terminal subdomain of 33 amino acids. The C-terminal subdomain of the AHD is critical for the protein's function []. In yeast, Arv1p is important for the delivery of an early glycosylphosphatidylinositol GPI intermediate, GlcN-acylPI, to the first mannosyltransferase of GPI synthesis in the ER lumen []. It is important for the traffic of sterol in yeast and in humans. In eukaryotic cells, it may fuction in the sphingolipid metabolic pathway as a transporter of ceramides between the ER and Golgi []. 
Probab=36.91  E-value=1.2e+02  Score=24.21  Aligned_cols=16  Identities=19%  Similarity=0.445  Sum_probs=13.3

Q ss_pred             CCCCCCcchhhhhhhH
Q 025621          107 PRAHHCRVCKRCVLRM  122 (250)
Q Consensus       107 ~Rs~HC~~C~~CV~~~  122 (250)
                      .|--+|+.||+.++++
T Consensus        22 irLt~C~~C~~vaDkY   37 (208)
T PF04161_consen   22 IRLTKCPNCGKVADKY   37 (208)
T ss_pred             EEEeeccccCCcccce
Confidence            4556899999999988


No 59 
>PF06508 QueC:  Queuosine biosynthesis protein QueC;  InterPro: IPR018317 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome.  In Rhizobium meliloti (Sinorhizobium meliloti), a species in which the exo genes make succinoglycan, a symbiotically important exopolysaccharide, exsB is located nearby and affects succinoglycan levels, probably through polar effects on exsA expression or the same polycistronic mRNA [, ].  In Arthrobacter viscosus, the homologous gene is designated alu1 and is associated with an aluminum tolerance phenotype. When expressed in Escherichia coli, it conferred aliminium tolerance []. The entry also contains the gene queC, which is responsible for the conversion of GTP to 7-cyano-7-deazaguanine (preQ0). The biosynthesis of hypermodified tRNA nucleoside queuosine only occurs in eubacteria. It occupies the wobble position for all known tRNAs that are specific for Asp, Asn, His or Tyr [].; PDB: 3BL5_B 2PG3_A.
Probab=36.84  E-value=19  Score=28.78  Aligned_cols=28  Identities=29%  Similarity=0.649  Sum_probs=18.5

Q ss_pred             CcccccccccccCCCCCCCcchhhhhhhH
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      ....-.+|..-. ....||..|..|+.|.
T Consensus       176 ~~~~T~SCy~~~-~~~~~CG~C~~C~~R~  203 (209)
T PF06508_consen  176 PLELTWSCYRGG-EKGKHCGRCPSCLLRR  203 (209)
T ss_dssp             HHHH-B-STTS---BTTTTSSSHHHHHHH
T ss_pred             CHHHccCCCCCC-CCCCCCCCCHHHHHHH
Confidence            456777774333 4568999999999985


No 60 
>TIGR00155 pqiA_fam integral membrane protein, PqiA family. This family consists of uncharacterized predicted integral membrane proteins found, so far, only in the Proteobacteria. Of two members in E. coli, one is induced by paraquat and is designated PqiA, paraquat-inducible protein A.
Probab=36.83  E-value=1.2e+02  Score=26.95  Aligned_cols=29  Identities=14%  Similarity=0.346  Sum_probs=19.2

Q ss_pred             Cccccccccccc------CCCCCCCcchhhhhhhH
Q 025621           94 DLRYCQKCSHYK------PPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        94 ~~~~C~~C~~~k------p~Rs~HC~~C~~CV~~~  122 (250)
                      ...-|+.|+...      +...-||+.||.-..+.
T Consensus        12 ~~~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~~   46 (403)
T TIGR00155        12 KHILCSQCDMLVALPRIESGQKAACPRCGTTLTVG   46 (403)
T ss_pred             CeeeCCCCCCcccccCCCCCCeeECCCCCCCCcCC
Confidence            345699999543      22334688888877665


No 61 
>COG1852 Uncharacterized conserved protein [Function unknown]
Probab=36.58  E-value=14  Score=28.91  Aligned_cols=23  Identities=30%  Similarity=0.817  Sum_probs=18.4

Q ss_pred             ccccccCCCCCCCcchhhhhhhH
Q 025621          100 KCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus       100 ~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      .|+..-.+--.-|+.||+||..-
T Consensus       102 ~CeA~~t~~G~~Ck~CgkCvi~e  124 (209)
T COG1852         102 KCEAKLTPTGYECKKCGKCVIGE  124 (209)
T ss_pred             CCccccccccceecccCCeehHH
Confidence            47777666688999999999753


No 62 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=36.18  E-value=19  Score=34.03  Aligned_cols=28  Identities=21%  Similarity=0.495  Sum_probs=24.7

Q ss_pred             cccccccccccCCCCCCCcchhhhhhhH
Q 025621           95 LRYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        95 ~~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      .+.|..|....|+.+++|..||.=....
T Consensus        27 ~~~Cp~CG~~~~~~~~fC~~CG~~~~~~   54 (645)
T PRK14559         27 HKPCPQCGTEVPVDEAHCPNCGAETGTI   54 (645)
T ss_pred             CCcCCCCCCCCCcccccccccCCcccch
Confidence            3679999999999999999999887776


No 63 
>PF07754 DUF1610:  Domain of unknown function (DUF1610);  InterPro: IPR011668 This domain is found in archaeal species. It is likely to bind zinc via its four well-conserved cysteine residues.
Probab=35.78  E-value=20  Score=17.94  Aligned_cols=19  Identities=32%  Similarity=0.861  Sum_probs=9.6

Q ss_pred             ccccccccCCCC----CCCcchh
Q 025621           98 CQKCSHYKPPRA----HHCRVCK  116 (250)
Q Consensus        98 C~~C~~~kp~Rs----~HC~~C~  116 (250)
                      |..|...-.+|-    ..|+.||
T Consensus         1 C~sC~~~i~~r~~~v~f~CPnCG   23 (24)
T PF07754_consen    1 CTSCGRPIAPREQAVPFPCPNCG   23 (24)
T ss_pred             CccCCCcccCcccCceEeCCCCC
Confidence            455554444443    3566665


No 64 
>PHA02942 putative transposase; Provisional
Probab=34.98  E-value=17  Score=31.94  Aligned_cols=26  Identities=31%  Similarity=0.545  Sum_probs=19.8

Q ss_pred             CcccccccccccCC---CCCCCcchhhhh
Q 025621           94 DLRYCQKCSHYKPP---RAHHCRVCKRCV  119 (250)
Q Consensus        94 ~~~~C~~C~~~kp~---Rs~HC~~C~~CV  119 (250)
                      ..+.|+.|....+.   |.++|..||-=.
T Consensus       324 TSq~Cs~CG~~~~~l~~r~f~C~~CG~~~  352 (383)
T PHA02942        324 SSVSCPKCGHKMVEIAHRYFHCPSCGYEN  352 (383)
T ss_pred             CCccCCCCCCccCcCCCCEEECCCCCCEe
Confidence            56899999976543   778999888633


No 65 
>PHA02898 virion envelope protein; Provisional
Probab=34.77  E-value=1.5e+02  Score=20.14  Aligned_cols=25  Identities=16%  Similarity=0.052  Sum_probs=15.6

Q ss_pred             HHHHHHHHHHHHHHHH-hccCcchHH
Q 025621          157 PLSVALSVLLGWHIYL-IFHNKTTIE  181 (250)
Q Consensus       157 ~~~~~~~~ll~~~~~l-i~~n~TT~E  181 (250)
                      +..+.+.+++++.+|- -+++.++.|
T Consensus        54 lgivl~lG~~ifs~y~r~C~~~~~~e   79 (92)
T PHA02898         54 LAIILILGIIFFKGYNMFCGGNTTDE   79 (92)
T ss_pred             HHHHHHHHHHHHHHHhhhcCCCcccc
Confidence            3344455677777776 667776664


No 66 
>PRK13130 H/ACA RNA-protein complex component Nop10p; Reviewed
Probab=33.98  E-value=21  Score=22.04  Aligned_cols=22  Identities=36%  Similarity=0.865  Sum_probs=16.5

Q ss_pred             CcccccccccccCCCCCCCcchhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      ..+.|..|...--  ...|+.||.
T Consensus         4 ~mr~C~~CgvYTL--k~~CP~CG~   25 (56)
T PRK13130          4 KIRKCPKCGVYTL--KEICPVCGG   25 (56)
T ss_pred             cceECCCCCCEEc--cccCcCCCC
Confidence            4578888888776  677888774


No 67 
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG. Member of this ferredoxin-like protein family are found exclusively in species with an operon encoding the cbb3 type of cytochrome c oxidase (cco-cbb3), and near the cco-cbb3 operon in about half the cases. The cco-cbb3 is found in a variety of proteobacteria and almost nowhere else, and is associated with oxygen use under microaerobic conditions. Some (but not all) of these proteobacteria are also nitrogen-fixing, hence the gene symbol fixG. FixG was shown essential for functional cco-cbb3 expression in Bradyrhizobium japonicum.
Probab=33.19  E-value=1.5e+02  Score=26.68  Aligned_cols=12  Identities=25%  Similarity=0.656  Sum_probs=9.7

Q ss_pred             CCCcchhhhhhh
Q 025621          110 HHCRVCKRCVLR  121 (250)
Q Consensus       110 ~HC~~C~~CV~~  121 (250)
                      ..|..|+.|+..
T Consensus       255 ~~Ci~Cg~Cida  266 (434)
T TIGR02745       255 LECINCGLCIDA  266 (434)
T ss_pred             hhChhhhHHHHh
Confidence            469999999875


No 68 
>PF06143 Baculo_11_kDa:  Baculovirus 11 kDa family;  InterPro: IPR009313 This is a family of uncharacterised Baculovirus proteins that are all about 11 kDa in size.
Probab=32.88  E-value=1.6e+02  Score=19.88  Aligned_cols=8  Identities=38%  Similarity=0.522  Sum_probs=3.8

Q ss_pred             HHHhccCc
Q 025621          170 IYLIFHNK  177 (250)
Q Consensus       170 ~~li~~n~  177 (250)
                      ++.|.+|.
T Consensus        56 l~~i~~~~   63 (84)
T PF06143_consen   56 LYNINKNA   63 (84)
T ss_pred             HHHHHHHH
Confidence            34444554


No 69 
>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]
Probab=32.12  E-value=18  Score=30.98  Aligned_cols=26  Identities=23%  Similarity=0.499  Sum_probs=22.3

Q ss_pred             CCcccccccccccCCCCCCCcchhhh
Q 025621           93 GDLRYCQKCSHYKPPRAHHCRVCKRC  118 (250)
Q Consensus        93 ~~~~~C~~C~~~kp~Rs~HC~~C~~C  118 (250)
                      .....|..|.--.-.--.||+.|++-
T Consensus       352 ~~~YRC~~CGF~a~~l~W~CPsC~~W  377 (389)
T COG2956         352 KPRYRCQNCGFTAHTLYWHCPSCRAW  377 (389)
T ss_pred             cCCceecccCCcceeeeeeCCCcccc
Confidence            46788999998888888899999873


No 70 
>KOG0230 consensus Phosphatidylinositol-4-phosphate 5-kinase and related FYVE finger-containing proteins [Signal transduction mechanisms]
Probab=31.32  E-value=22  Score=36.44  Aligned_cols=24  Identities=42%  Similarity=0.919  Sum_probs=17.2

Q ss_pred             CcccccccccccCCCCCCCcchhhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKRC  118 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~C  118 (250)
                      ..+.|..|. -+-.|.|||+.||+|
T Consensus         4 s~~~~~~~~-t~~~~~~~~~~~g~~   27 (1598)
T KOG0230|consen    4 SSNVCYDCD-TSVNRRHHCRVCGRV   27 (1598)
T ss_pred             cccchhccc-cccccCCCCcccCce
Confidence            346677777 666778888888884


No 71 
>KOG1729 consensus FYVE finger containing protein [General function prediction only]
Probab=30.95  E-value=11  Score=31.65  Aligned_cols=26  Identities=35%  Similarity=0.723  Sum_probs=17.5

Q ss_pred             Ccccccccccc---cCCCCCCCcchhhhh
Q 025621           94 DLRYCQKCSHY---KPPRAHHCRVCKRCV  119 (250)
Q Consensus        94 ~~~~C~~C~~~---kp~Rs~HC~~C~~CV  119 (250)
                      ....|..|...   --.|-|||+.||.=|
T Consensus       167 ea~~C~~C~~~~Ftl~~RRHHCR~CG~iv  195 (288)
T KOG1729|consen  167 EATECMVCGCTEFTLSERRHHCRNCGDIV  195 (288)
T ss_pred             cceecccCCCccccHHHHHHHHHhcchHh
Confidence            44677777762   246778988888743


No 72 
>PRK14559 putative protein serine/threonine phosphatase; Provisional
Probab=30.95  E-value=26  Score=33.08  Aligned_cols=23  Identities=30%  Similarity=0.712  Sum_probs=13.7

Q ss_pred             CcccccccccccCCCCCCCcchhhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKRC  118 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~C  118 (250)
                      ..+||..|...-+  .+.|+.||.=
T Consensus        14 ~akFC~~CG~~l~--~~~Cp~CG~~   36 (645)
T PRK14559         14 NNRFCQKCGTSLT--HKPCPQCGTE   36 (645)
T ss_pred             CCccccccCCCCC--CCcCCCCCCC
Confidence            4578888866533  2456666543


No 73 
>PRK12380 hydrogenase nickel incorporation protein HybF; Provisional
Probab=30.73  E-value=23  Score=25.21  Aligned_cols=24  Identities=25%  Similarity=0.645  Sum_probs=16.5

Q ss_pred             CcccccccccccCCCCCC--Ccchhh
Q 025621           94 DLRYCQKCSHYKPPRAHH--CRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~H--C~~C~~  117 (250)
                      ..-+|..|...-+....+  |+.||.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (113)
T PRK12380         69 AQAWCWDCSQVVEIHQHDAQCPHCHG   94 (113)
T ss_pred             cEEEcccCCCEEecCCcCccCcCCCC
Confidence            457899998765554333  888873


No 74 
>KOG2927 consensus Membrane component of ER protein translocation complex [Intracellular trafficking, secretion, and vesicular transport]
Probab=30.43  E-value=1.1e+02  Score=26.47  Aligned_cols=16  Identities=19%  Similarity=0.251  Sum_probs=9.2

Q ss_pred             ccccccccCCCCCCCc
Q 025621           98 CQKCSHYKPPRAHHCR  113 (250)
Q Consensus        98 C~~C~~~kp~Rs~HC~  113 (250)
                      |-.|...+|.-++|=.
T Consensus       266 vGfleSF~PLy~~~~~  281 (372)
T KOG2927|consen  266 VGFLESFKPLYEYHYK  281 (372)
T ss_pred             hhHHHhhcccccccCC
Confidence            5556666666555543


No 75 
>PRK15103 paraquat-inducible membrane protein A; Provisional
Probab=30.11  E-value=1.8e+02  Score=26.04  Aligned_cols=27  Identities=15%  Similarity=0.388  Sum_probs=19.1

Q ss_pred             cccccccccc------CCCCCCCcchhhhhhhH
Q 025621           96 RYCQKCSHYK------PPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        96 ~~C~~C~~~k------p~Rs~HC~~C~~CV~~~  122 (250)
                      .-|+.|+...      +...-||+.||.-..+.
T Consensus        11 ~~C~~Cd~l~~~~~l~~g~~a~CpRCg~~L~~~   43 (419)
T PRK15103         11 ILCPQCDMLVALPRLEHGQKAACPRCGTTLTVR   43 (419)
T ss_pred             ccCCCCCceeecCCCCCCCeeECCCCCCCCcCC
Confidence            5599999653      23345788888888766


No 76 
>PRK00159 putative septation inhibitor protein; Reviewed
Probab=29.87  E-value=1.8e+02  Score=19.71  Aligned_cols=29  Identities=10%  Similarity=-0.003  Sum_probs=17.7

Q ss_pred             CcccchhHHHHHHHHHHHHHHHHHhhhcc
Q 025621            4 GFTFSLPVSVVVLAIFYIYFTTVFIFIDR   32 (250)
Q Consensus         4 ~~~~~~p~~~~~~l~~~~~~~~~~~~~~~   32 (250)
                      +...|..++.+.++++.+.+..++++...
T Consensus        28 ~sp~W~~~~m~glm~~GllWlvvyYl~~~   56 (87)
T PRK00159         28 PSSVWYVVLMLGLMLIGLAWLVVNYLAGP   56 (87)
T ss_pred             CCCccHHHHHHHHHHHHHHHHHHHhhccC
Confidence            34566666666666666666666665533


No 77 
>KOG4606 consensus Uncharacterized conserved protein [Function unknown]
Probab=29.67  E-value=1.4e+02  Score=21.00  Aligned_cols=55  Identities=11%  Similarity=-0.161  Sum_probs=28.2

Q ss_pred             CCCCcccchhHHHHHHHHHHHHHHHHHhhhccccccCCcchhHHHHHHHHHHHHH
Q 025621            1 MTKGFTFSLPVSVVVLAIFYIYFTTVFIFIDRWFGLMSSPGLMNAIVFTAVALMC   55 (250)
Q Consensus         1 ~~~~~~~~~p~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~ii~~~l~~~~   55 (250)
                      |+-..+.|=.++.++++......++.+..=|.........+.+....|++.++..
T Consensus        24 ~~Pst~RWRi~lvi~svc~gaigawywl~dpet~~vp~~~sLw~Hp~FTi~~~tL   78 (126)
T KOG4606|consen   24 MGPSTGRWRIALVIFSVCTGAIGAWYWLIDPETQKVPFFTSLWNHPFFTISFITL   78 (126)
T ss_pred             cCCCccchhhHHHHHHHHHHhhhhhhhhcCcceeeeehHHHHhcCccHHHHHHHH
Confidence            4455666767777766666555566655544433322223334344455444443


No 78 
>PF03107 C1_2:  C1 domain;  InterPro: IPR004146 This short domain is rich in cysteines and histidines. The pattern of conservation is similar to that found in DAG_PE-bind (IPR002219 from INTERPRO), therefore we have termed this domain DC1 for divergent C1 domain. This domain probably also binds to two zinc ions. The function of proteins with this domain is uncertain, however this domain may bind to molecules such as diacylglycerol. This family are found in plant proteins.
Probab=29.02  E-value=23  Score=18.47  Aligned_cols=20  Identities=25%  Similarity=0.610  Sum_probs=11.6

Q ss_pred             cccccccccCCC-CCCCcchh
Q 025621           97 YCQKCSHYKPPR-AHHCRVCK  116 (250)
Q Consensus        97 ~C~~C~~~kp~R-s~HC~~C~  116 (250)
                      .|..|+...... ..||+.|+
T Consensus         2 ~C~~C~~~~~~~~~Y~C~~c~   22 (30)
T PF03107_consen    2 WCDVCRRKIDGFYFYHCSECC   22 (30)
T ss_pred             CCCCCCCCcCCCEeEEeCCCC
Confidence            356666555555 56666554


No 79 
>TIGR00100 hypA hydrogenase nickel insertion protein HypA. In Hpylori, hypA mutant abolished hydrogenase activity and decrease in urease activity. Nickel supplementation in media restored urease activity and partial hydrogenase activity. HypA probably involved in inserting Ni in enzymes.
Probab=28.99  E-value=27  Score=24.98  Aligned_cols=24  Identities=25%  Similarity=0.524  Sum_probs=17.7

Q ss_pred             CcccccccccccCC--CCCCCcchhh
Q 025621           94 DLRYCQKCSHYKPP--RAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~--Rs~HC~~C~~  117 (250)
                      ..-+|..|...-+.  +..+|+.|+.
T Consensus        69 ~~~~C~~Cg~~~~~~~~~~~CP~Cgs   94 (115)
T TIGR00100        69 VECECEDCSEEVSPEIDLYRCPKCHG   94 (115)
T ss_pred             cEEEcccCCCEEecCCcCccCcCCcC
Confidence            45899999877655  3567999874


No 80 
>PRK10692 hypothetical protein; Provisional
Probab=28.79  E-value=1.9e+02  Score=19.58  Aligned_cols=18  Identities=0%  Similarity=0.008  Sum_probs=8.2

Q ss_pred             chhHHHHHHHHHHHHHHH
Q 025621           40 PGLMNAIVFTAVALMCVF   57 (250)
Q Consensus        40 ~~~~~~ii~~~l~~~~~~   57 (250)
                      ....+..++.++....+|
T Consensus        40 ~~~~~gal~~IFiGAllW   57 (92)
T PRK10692         40 QFFAHGALLSIFVGALLW   57 (92)
T ss_pred             HHHHhhHHHHHHHHHHHH
Confidence            334444555554444443


No 81 
>PF12172 DUF35_N:  Rubredoxin-like zinc ribbon domain (DUF35_N);  InterPro: IPR022002  This domain has no known function and is found in conserved hypothetical archaeal and bacterial proteins. The domain is duplicated in O53566 from SWISSPROT. The structure of a DUF35 representative reveals two long N-terminal helices followed by a rubredoxin-like zinc ribbon domain represented in this family and a C-terminal OB fold domain. Zinc is chelated by the four conserved cysteines in the alignment. ; PDB: 3IRB_A.
Probab=28.71  E-value=13  Score=20.42  Aligned_cols=22  Identities=32%  Similarity=0.738  Sum_probs=12.7

Q ss_pred             Ccccccccccc-cCCCCCCCcchh
Q 025621           94 DLRYCQKCSHY-KPPRAHHCRVCK  116 (250)
Q Consensus        94 ~~~~C~~C~~~-kp~Rs~HC~~C~  116 (250)
                      ..+.|..|..+ -|+| ..|+.|+
T Consensus        10 ~~~rC~~Cg~~~~pPr-~~Cp~C~   32 (37)
T PF12172_consen   10 LGQRCRDCGRVQFPPR-PVCPHCG   32 (37)
T ss_dssp             EEEE-TTT--EEES---SEETTTT
T ss_pred             EEEEcCCCCCEecCCC-cCCCCcC
Confidence            46899999988 4555 7787775


No 82 
>PRK00564 hypA hydrogenase nickel incorporation protein; Provisional
Probab=28.08  E-value=29  Score=24.88  Aligned_cols=24  Identities=33%  Similarity=0.641  Sum_probs=17.0

Q ss_pred             CcccccccccccCCCCC---CCcchhh
Q 025621           94 DLRYCQKCSHYKPPRAH---HCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~---HC~~C~~  117 (250)
                      ..-+|..|...-+....   +|+.||.
T Consensus        70 ~~~~C~~Cg~~~~~~~~~~~~CP~Cgs   96 (117)
T PRK00564         70 VELECKDCSHVFKPNALDYGVCEKCHS   96 (117)
T ss_pred             CEEEhhhCCCccccCCccCCcCcCCCC
Confidence            45899999877655432   5998884


No 83 
>PF12837 Fer4_6:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=27.85  E-value=26  Score=17.36  Aligned_cols=9  Identities=44%  Similarity=1.058  Sum_probs=5.9

Q ss_pred             Ccchhhhhh
Q 025621          112 CRVCKRCVL  120 (250)
Q Consensus       112 C~~C~~CV~  120 (250)
                      |..|++|+.
T Consensus         9 C~~Cg~C~~   17 (24)
T PF12837_consen    9 CIGCGDCVR   17 (24)
T ss_pred             CcChhHHHH
Confidence            566777764


No 84 
>PLN00186 ribosomal protein S26; Provisional
Probab=27.82  E-value=18  Score=25.41  Aligned_cols=14  Identities=29%  Similarity=0.769  Sum_probs=11.6

Q ss_pred             CCCCcchhhhhhhH
Q 025621          109 AHHCRVCKRCVLRM  122 (250)
Q Consensus       109 s~HC~~C~~CV~~~  122 (250)
                      .-||..|++||-+=
T Consensus        20 ~V~C~nCgr~vPKD   33 (109)
T PLN00186         20 RIRCSNCGKCVPKD   33 (109)
T ss_pred             ceeeCCCccccccc
Confidence            45899999999864


No 85 
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]
Probab=27.33  E-value=31  Score=29.77  Aligned_cols=17  Identities=35%  Similarity=1.001  Sum_probs=13.5

Q ss_pred             cCCCCCCCcchhhhhhh
Q 025621          105 KPPRAHHCRVCKRCVLR  121 (250)
Q Consensus       105 kp~Rs~HC~~C~~CV~~  121 (250)
                      +|....||..|.+|+..
T Consensus       180 ~p~~~~~Cg~C~~Clda  196 (337)
T COG1600         180 RPEEEDHCGSCTRCLDA  196 (337)
T ss_pred             CCCCCccChhhHHHHhh
Confidence            45555899999999975


No 86 
>COG1645 Uncharacterized Zn-finger containing protein [General function prediction only]
Probab=25.55  E-value=22  Score=26.10  Aligned_cols=9  Identities=44%  Similarity=1.040  Sum_probs=6.6

Q ss_pred             CCCCcchhh
Q 025621          109 AHHCRVCKR  117 (250)
Q Consensus       109 s~HC~~C~~  117 (250)
                      ++||+.||.
T Consensus        28 ~~hCp~Cg~   36 (131)
T COG1645          28 AKHCPKCGT   36 (131)
T ss_pred             HhhCcccCC
Confidence            678888774


No 87 
>PF10762 DUF2583:  Protein of unknown function (DUF2583)   ;  InterPro: IPR019698  Some members in this entry are annotated as YchH however currently no function is known. 
Probab=25.43  E-value=2.2e+02  Score=19.17  Aligned_cols=17  Identities=12%  Similarity=0.131  Sum_probs=7.7

Q ss_pred             hhHHHHHHHHHHHHHHH
Q 025621           41 GLMNAIVFTAVALMCVF   57 (250)
Q Consensus        41 ~~~~~ii~~~l~~~~~~   57 (250)
                      ...+..++.++....+|
T Consensus        41 ~~~~gal~~IFiGAllW   57 (89)
T PF10762_consen   41 FLAHGALFSIFIGALLW   57 (89)
T ss_pred             HHHhhHHHHHHHHHHHH
Confidence            33444455544444443


No 88 
>KOG1710 consensus MYND Zn-finger and ankyrin repeat protein [General function prediction only]
Probab=25.17  E-value=33  Score=28.92  Aligned_cols=21  Identities=33%  Similarity=0.963  Sum_probs=16.2

Q ss_pred             CcccccccccccCCCCCCCcchh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCK  116 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~  116 (250)
                      ..+||++|...+|.  |.|+.|.
T Consensus       318 d~~fCstCG~~ga~--KrCs~CK  338 (396)
T KOG1710|consen  318 DCQFCSTCGHPGAK--KRCSQCK  338 (396)
T ss_pred             ecccccccCCCCcc--chhhhhH
Confidence            46999999998874  5666665


No 89 
>PF12798 Fer4_3:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding
Probab=25.01  E-value=32  Score=14.90  Aligned_cols=9  Identities=44%  Similarity=1.106  Sum_probs=4.6

Q ss_pred             Ccchhhhhh
Q 025621          112 CRVCKRCVL  120 (250)
Q Consensus       112 C~~C~~CV~  120 (250)
                      |..|+.|+.
T Consensus         1 C~~C~~C~~    9 (15)
T PF12798_consen    1 CTGCGACVE    9 (15)
T ss_pred             CCCchHHHH
Confidence            344566653


No 90 
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only]
Probab=24.98  E-value=43  Score=27.06  Aligned_cols=18  Identities=39%  Similarity=0.881  Sum_probs=14.0

Q ss_pred             cCCCCCCCcchhhhhhhH
Q 025621          105 KPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus       105 kp~Rs~HC~~C~~CV~~~  122 (250)
                      .+.+-.||..|.-|+.|.
T Consensus       188 ~g~~~~~CG~C~sC~~R~  205 (222)
T COG0603         188 NGGEGDHCGECESCVLRE  205 (222)
T ss_pred             CCCCCCCCCCCHHHHHHH
Confidence            344444999999999986


No 91 
>PF11023 DUF2614:  Protein of unknown function (DUF2614);  InterPro: IPR020912 This entry describes proteins of unknown function, which are thought to be membrane proteins.; GO: 0005887 integral to plasma membrane
Probab=24.69  E-value=2.7e+02  Score=19.91  Aligned_cols=8  Identities=25%  Similarity=0.841  Sum_probs=3.9

Q ss_pred             cccccccc
Q 025621           97 YCQKCSHY  104 (250)
Q Consensus        97 ~C~~C~~~  104 (250)
                      .|+.|+..
T Consensus        71 ~CP~C~K~   78 (114)
T PF11023_consen   71 ECPNCGKQ   78 (114)
T ss_pred             ECCCCCCh
Confidence            35555533


No 92 
>PF00037 Fer4:  4Fe-4S binding domain;  InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters. Members include bacterial ferredoxins, various dehydrogenases, and various reductases. Structure of the domain is an alpha-antiparallel beta sandwich. Ferredoxins are iron-sulphur proteins that mediate electron transfer in a range of metabolic reactions; they fall into several subgroups according to the nature of their iron-sulphur cluster(s) [, ]. One group, originally found in bacteria, has been termed "bacterial-type", in which the active centre is a 4Fe-4S cluster. 4Fe-4S ferredoxins may in turn be subdivided into further groups, based on their sequence properties. Most contain at least one conserved domain, including four Cys residues that bind to a 4Fe-4S centre. ; GO: 0009055 electron carrier activity, 0051536 iron-sulfur cluster binding; PDB: 1DUR_A 1H98_A 1BD6_A 1BQX_A 1BWE_A 1BC6_A 3BK7_A 1FCA_A 1FDN_A 2FDN_A ....
Probab=24.68  E-value=30  Score=16.96  Aligned_cols=10  Identities=50%  Similarity=1.119  Sum_probs=5.5

Q ss_pred             CCcchhhhhh
Q 025621          111 HCRVCKRCVL  120 (250)
Q Consensus       111 HC~~C~~CV~  120 (250)
                      .|..|++|+.
T Consensus         7 ~C~~Cg~C~~   16 (24)
T PF00037_consen    7 KCIGCGRCVE   16 (24)
T ss_dssp             TSSS-THHHH
T ss_pred             HCCCcchhhh
Confidence            4666677653


No 93 
>PRK09335 30S ribosomal protein S26e; Provisional
Probab=24.64  E-value=21  Score=24.50  Aligned_cols=14  Identities=36%  Similarity=0.517  Sum_probs=11.8

Q ss_pred             CCCCcchhhhhhhH
Q 025621          109 AHHCRVCKRCVLRM  122 (250)
Q Consensus       109 s~HC~~C~~CV~~~  122 (250)
                      .-||..|++||-+-
T Consensus        20 ~V~C~nCgr~vPKD   33 (95)
T PRK09335         20 YVQCDNCGRRVPRD   33 (95)
T ss_pred             cEEeCCCCCcCcCC
Confidence            45899999999876


No 94 
>KOG4399 consensus C2HC-type Zn-finger protein [General function prediction only]
Probab=24.46  E-value=36  Score=28.00  Aligned_cols=23  Identities=22%  Similarity=0.385  Sum_probs=12.8

Q ss_pred             cccccccccccCCCCCCCcchhhh
Q 025621           95 LRYCQKCSHYKPPRAHHCRVCKRC  118 (250)
Q Consensus        95 ~~~C~~C~~~kp~Rs~HC~~C~~C  118 (250)
                      .+.|..|+...-.| .||..|..|
T Consensus       261 ~~~C~iC~~~~~~R-~~C~~~kA~  283 (325)
T KOG4399|consen  261 KHGCFICGELDHKR-STCPNIKAV  283 (325)
T ss_pred             hcceeecccccccc-ccCccHHHH
Confidence            45566666666666 555554444


No 95 
>PF12387 Peptidase_C74:  Pestivirus NS2 peptidase;  InterPro: IPR022120  The pestivirus NS2 peptidase is responsible for single cleavage between NS2 and NS3 of the Bovine viral diarrhea virus 1 polyprotein, a cleavage that is correlated with cytopathogenicity []. The peptidase is activated by its interaction with 'J-domain protein interacting with viral protein' - Jiv. ; GO: 0003968 RNA-directed RNA polymerase activity, 0004197 cysteine-type endopeptidase activity, 0004252 serine-type endopeptidase activity, 0016817 hydrolase activity, acting on acid anhydrides, 0017111 nucleoside-triphosphatase activity, 0070008 serine-type exopeptidase activity
Probab=24.42  E-value=36  Score=26.10  Aligned_cols=22  Identities=23%  Similarity=0.529  Sum_probs=12.7

Q ss_pred             ccccccccccCCCCCCCcchhhh
Q 025621           96 RYCQKCSHYKPPRAHHCRVCKRC  118 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs~HC~~C~~C  118 (250)
                      -.|..|+..+=.+. -|+.|||.
T Consensus       163 ilCtvCe~r~w~g~-~CPKCGr~  184 (200)
T PF12387_consen  163 ILCTVCEGREWKGG-NCPKCGRH  184 (200)
T ss_pred             EEEeeeecCccCCC-CCCcccCC
Confidence            45666665544333 38888764


No 96 
>PRK11106 queuosine biosynthesis protein QueC; Provisional
Probab=24.26  E-value=45  Score=27.13  Aligned_cols=25  Identities=24%  Similarity=0.550  Sum_probs=16.9

Q ss_pred             ccccccccccCCCCCCCcchhhhhhhH
Q 025621           96 RYCQKCSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      ..=.+|-.  +.+..||..|+.|..|.
T Consensus       183 ~~T~SCy~--g~~g~~CG~C~sC~~R~  207 (231)
T PRK11106        183 HETLTCYN--GIKGDGCGHCAACHLRA  207 (231)
T ss_pred             CceeeccC--cCCCCCCCCCHHHHHHH
Confidence            45556654  22224999999999985


No 97 
>PF08772 NOB1_Zn_bind:  Nin one binding (NOB1) Zn-ribbon like;  InterPro: IPR014881 This entry corresponds to a zinc ribbon and is found on the RNA binding protein NOB1. ; PDB: 2CON_A.
Probab=24.24  E-value=32  Score=22.48  Aligned_cols=25  Identities=16%  Similarity=0.425  Sum_probs=12.0

Q ss_pred             CcccccccccccCCCCC-CCcchhhh
Q 025621           94 DLRYCQKCSHYKPPRAH-HCRVCKRC  118 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~-HC~~C~~C  118 (250)
                      ....|..|...-++.++ -|+.||.=
T Consensus         8 ~vlrC~aCf~~t~~~~k~FCp~CGn~   33 (73)
T PF08772_consen    8 WVLRCHACFKITKDMTKQFCPKCGNA   33 (73)
T ss_dssp             EEEE-SSS--EES-SS--S-SSS--S
T ss_pred             eeEEccccccCcCCCCceeCcccCCC
Confidence            34678888888776665 78888764


No 98 
>PF06689 zf-C4_ClpX:  ClpX C4-type zinc finger;  InterPro: IPR010603 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule. Some of these domains bind zinc, but many do not; instead binding other metals such as iron, or no metal at all. For example, some family members form salt bridges to stabilise the finger-like folds. They were first identified as a DNA-binding motif in transcription factor TFIIIA from Xenopus laevis (African clawed frog), however they are now recognised to bind DNA, RNA, protein and/or lipid substrates [, , , , ]. Their binding properties depend on the amino acid sequence of the finger domains and of the linker between fingers, as well as on the higher-order structures and the number of fingers. Znf domains are often found in clusters, where fingers can have different binding specificities. There are many superfamilies of Znf motifs, varying in both sequence and structure. They display considerable versatility in binding modes, even between members of the same class (e.g. some bind DNA, others protein), suggesting that Znf motifs are stable scaffolds that have evolved specialised functions. For example, Znf-containing proteins function in gene transcription, translation, mRNA trafficking, cytoskeleton organisation, epithelial development, cell adhesion, protein folding, chromatin remodelling and zinc sensing, to name but a few []. Zinc-binding motifs are stable structures, and they rarely undergo conformational changes upon binding their target.  The ClpX heat shock protein of Escherichia coli is a member of the universally conserved Hsp100 family of proteins, and possesses a putative zinc finger motif of the C4 type []. This presumed zinc binding domain (ZBD) is found at the N terminus of the ClpX protein. ClpX is an ATPase which functions both as a substrate specificity component of the ClpXP protease and as a molecular chaperone. ZBD is a member of the treble clef zinc finger family, a motif known to facilitate protein-ligand, protein-DNA, and protein-protein interactions and forms a constitutive dimer that is essential for the degradation of some, but not all, ClpX substrates []. More information about these proteins can be found at Protein of the Month: Zinc Fingers [].; GO: 0008270 zinc ion binding, 0016887 ATPase activity, 0046983 protein dimerization activity, 0006200 ATP catabolic process, 0019538 protein metabolic process; PDB: 2DS8_B 2DS6_B 2DS5_A 1OVX_A 2DS7_A.
Probab=24.18  E-value=48  Score=18.81  Aligned_cols=27  Identities=19%  Similarity=0.559  Sum_probs=14.5

Q ss_pred             ccccccccccCCCC------CCCcchhhhhhhH
Q 025621           96 RYCQKCSHYKPPRA------HHCRVCKRCVLRM  122 (250)
Q Consensus        96 ~~C~~C~~~kp~Rs------~HC~~C~~CV~~~  122 (250)
                      ++|+.|.....+-.      .+-.+|+.||...
T Consensus         2 ~~CSFCgr~~~~v~~li~g~~~~~IC~~Cv~~~   34 (41)
T PF06689_consen    2 KRCSFCGRPESEVGRLISGPNGAYICDECVEQA   34 (41)
T ss_dssp             -B-TTT--BTTTSSSEEEES-SEEEEHHHHHHH
T ss_pred             CCccCCCCCHHHHhceecCCCCcEECHHHHHHH
Confidence            46777776654432      2577888888764


No 99 
>PTZ00172 40S ribosomal protein S26; Provisional
Probab=24.03  E-value=23  Score=24.95  Aligned_cols=14  Identities=36%  Similarity=0.842  Sum_probs=11.5

Q ss_pred             CCCCcchhhhhhhH
Q 025621          109 AHHCRVCKRCVLRM  122 (250)
Q Consensus       109 s~HC~~C~~CV~~~  122 (250)
                      .-||..|++||-+=
T Consensus        20 ~V~C~nCgr~vPKD   33 (108)
T PTZ00172         20 PVRCSNCGRCVPKD   33 (108)
T ss_pred             cEEeCCcccccccc
Confidence            45899999999864


No 100
>cd00350 rubredoxin_like Rubredoxin_like; nonheme iron binding domain containing a [Fe(SCys)4] center. The family includes rubredoxins, a small electron transfer protein, and a slightly smaller modular rubredoxin domain present in rubrerythrin and nigerythrin and detected either N- or C-terminal to such proteins as flavin reductase, NAD(P)H-nitrite reductase, and ferredoxin-thioredoxin reductase. In rubredoxin, the iron atom is coordinated by four cysteine residues (Fe(S-Cys)4), but iron can also be replaced by cobalt, nickel or zinc and believed to be involved in electron transfer.  Rubrerythrins and nigerythrins are small homodimeric proteins, generally consisting of 2 domains: a rubredoxin domain C-terminal to a non-sulfur, oxo-bridged diiron site in the N-terminal rubrerythrin domain.  Rubrerythrins and nigerythrins have putative peroxide activity.
Probab=22.58  E-value=59  Score=17.34  Aligned_cols=21  Identities=24%  Similarity=0.581  Sum_probs=10.4

Q ss_pred             cccccccc-cCC-CCCCCcchhh
Q 025621           97 YCQKCSHY-KPP-RAHHCRVCKR  117 (250)
Q Consensus        97 ~C~~C~~~-kp~-Rs~HC~~C~~  117 (250)
                      .|..|.-. .+. ....|+.|+.
T Consensus         3 ~C~~CGy~y~~~~~~~~CP~Cg~   25 (33)
T cd00350           3 VCPVCGYIYDGEEAPWVCPVCGA   25 (33)
T ss_pred             ECCCCCCEECCCcCCCcCcCCCC
Confidence            35555544 332 3446666653


No 101
>PRK06393 rpoE DNA-directed RNA polymerase subunit E''; Validated
Probab=22.40  E-value=42  Score=21.27  Aligned_cols=22  Identities=32%  Similarity=0.774  Sum_probs=15.5

Q ss_pred             CcccccccccccCCCCCCCcchhh
Q 025621           94 DLRYCQKCSHYKPPRAHHCRVCKR  117 (250)
Q Consensus        94 ~~~~C~~C~~~kp~Rs~HC~~C~~  117 (250)
                      ..+-|..|+....  ..-|+.||.
T Consensus         4 ~~~AC~~C~~i~~--~~~Cp~Cgs   25 (64)
T PRK06393          4 QYRACKKCKRLTP--EKTCPVHGD   25 (64)
T ss_pred             hhhhHhhCCcccC--CCcCCCCCC
Confidence            3467889998884  337777764


No 102
>PF14319 Zn_Tnp_IS91:  Transposase zinc-binding domain
Probab=22.04  E-value=50  Score=23.42  Aligned_cols=27  Identities=30%  Similarity=0.662  Sum_probs=17.8

Q ss_pred             CCCccccccccccc----CCCCCCCcchhhh
Q 025621           92 GGDLRYCQKCSHYK----PPRAHHCRVCKRC  118 (250)
Q Consensus        92 ~~~~~~C~~C~~~k----p~Rs~HC~~C~~C  118 (250)
                      +.....|..|...+    .=|+.||+.|+.=
T Consensus        39 G~~~~~C~~Cg~~~~~~~SCk~R~CP~C~~~   69 (111)
T PF14319_consen   39 GFHRYRCEDCGHEKIVYNSCKNRHCPSCQAK   69 (111)
T ss_pred             CcceeecCCCCceEEecCcccCcCCCCCCCh
Confidence            34567898898654    3355678877753


No 103
>KOG4800 consensus Neuronal membrane glycoprotein/Myelin proteolipid protein [Function unknown]
Probab=21.61  E-value=2e+02  Score=23.24  Aligned_cols=16  Identities=31%  Similarity=0.713  Sum_probs=10.5

Q ss_pred             CCcchhhhhhhHHHHH
Q 025621          111 HCRVCKRCVLRMVLLV  126 (250)
Q Consensus       111 HC~~C~~CV~~~~~~~  126 (250)
                      .-+.|||||...+..+
T Consensus       113 k~r~cGr~Vs~~f~~l  128 (248)
T KOG4800|consen  113 KTRMCGRCVSGVFVGL  128 (248)
T ss_pred             hceecCcchhhhhhHH
Confidence            3478999988843333


No 104
>PF01976 DUF116:  Protein of unknown function DUF116;  InterPro: IPR002829 These archaeal and bacterial proteins have no known function. Members of this family contain seven conserved cysteines and may also be an integral membrane protein.
Probab=21.01  E-value=55  Score=24.89  Aligned_cols=22  Identities=18%  Similarity=0.596  Sum_probs=18.6

Q ss_pred             cccccCCCCCCCcchhhhhhhH
Q 025621          101 CSHYKPPRAHHCRVCKRCVLRM  122 (250)
Q Consensus       101 C~~~kp~Rs~HC~~C~~CV~~~  122 (250)
                      |.......-..|+.||+|...-
T Consensus        56 C~~k~t~~g~~C~~Cg~C~Ig~   77 (158)
T PF01976_consen   56 CPAKITSDGYNCKRCGKCDIGD   77 (158)
T ss_pred             CCCccCCCCCcCCCCCCCchhH
Confidence            7777777888999999998764


No 105
>PF13829 DUF4191:  Domain of unknown function (DUF4191)
Probab=20.70  E-value=2.8e+02  Score=22.46  Aligned_cols=16  Identities=19%  Similarity=0.003  Sum_probs=7.8

Q ss_pred             CCCcccchhHHHHHHH
Q 025621            2 TKGFTFSLPVSVVVLA   17 (250)
Q Consensus         2 ~~~~~~~~p~~~~~~l   17 (250)
                      +++.-.+++...+..+
T Consensus        20 trk~dp~l~~~ml~a~   35 (224)
T PF13829_consen   20 TRKEDPKLPWLMLGAF   35 (224)
T ss_pred             HHHHCcchHHHHHHHH
Confidence            4445555555544433


No 106
>PF00130 C1_1:  Phorbol esters/diacylglycerol binding domain (C1 domain);  InterPro: IPR002219 Diacylglycerol (DAG) is an important second messenger. Phorbol esters (PE) are analogues of DAG and potent tumour promoters that cause a variety of physiological changes when administered to both cells and tissues. DAG activates a family of serine/threonine protein kinases, collectively known as protein kinase C (PKC) []. Phorbol esters can directly stimulate PKC. The N-terminal region of PKC, known as C1, has been shown [] to bind PE and DAG in a phospholipid and zinc-dependent fashion. The C1 region contains one or two copies (depending on the isozyme of PKC) of a cysteine-rich domain, which is about 50 amino-acid residues long, and which is essential for DAG/PE-binding. The DAG/PE-binding domain binds two zinc ions; the ligands of these metal ions are probably the six cysteines and two histidines that are conserved in this domain.; GO: 0035556 intracellular signal transduction; PDB: 1RFH_A 2FNF_X 3PFQ_A 1PTQ_A 1PTR_A 2VRW_B 1XA6_A 2ENN_A 1TBN_A 1TBO_A ....
Probab=20.50  E-value=28  Score=20.60  Aligned_cols=26  Identities=19%  Similarity=0.604  Sum_probs=17.8

Q ss_pred             Cccccccccccc---CCCCCCCcchhhhh
Q 025621           94 DLRYCQKCSHYK---PPRAHHCRVCKRCV  119 (250)
Q Consensus        94 ~~~~C~~C~~~k---p~Rs~HC~~C~~CV  119 (250)
                      ...+|..|+..-   .....+|+.|+.-+
T Consensus        10 ~~~~C~~C~~~i~g~~~~g~~C~~C~~~~   38 (53)
T PF00130_consen   10 KPTYCDVCGKFIWGLGKQGYRCSWCGLVC   38 (53)
T ss_dssp             STEB-TTSSSBECSSSSCEEEETTTT-EE
T ss_pred             CCCCCcccCcccCCCCCCeEEECCCCChH
Confidence            568899998776   55666888887644


No 107
>PRK14132 riboflavin kinase; Provisional
Probab=20.10  E-value=38  Score=24.70  Aligned_cols=16  Identities=13%  Similarity=0.160  Sum_probs=13.0

Q ss_pred             ccccccccCCCCCCCc
Q 025621           98 CQKCSHYKPPRAHHCR  113 (250)
Q Consensus        98 C~~C~~~kp~Rs~HC~  113 (250)
                      .-.|.++.|.||||=.
T Consensus        84 ~i~~aiV~P~rT~h~~   99 (126)
T PRK14132         84 EIDGAIVFPKKTDHSK   99 (126)
T ss_pred             ceeEEEEEeccCCCCC
Confidence            4568889999999965


Done!