Citrus Sinensis ID: 025633


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250
MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR
cccccHHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccc
cccccHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccEHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEcccccEccHHHHHHHHHHHHHHHHHHccccccccEEEEEEEcccccccccccccccccccccHHcccHHHHHHHHHHHHHHHHHHHccc
MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFAnrfslknkpvhVLVNNagvlennrlitsegFELNFAVNVLGTYTITESMVpllekaapdarvitvssggmytahltddlefnsgsfdgMEQYARNKRVQVALTEKWSEMYKEkgigfysmhpgwaetpgvaksmpsfnerfagnlrtseegADTVLWLALqpkeklvsgsfyfdraeapkHLKFAATAASHARIDPIVDVLRSMANLR
mvcrskekgetalsairsktgnenvHLELCDLSSITEIKSFAnrfslknkpvHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAataasharidpIVDVLRSMANLR
MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR
***********************NVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPG*********************GADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVL*******
MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPK*********SHARIDPIVDVLRSMANLR
***********ALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR
*VCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMA***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIVDVLRSMANLR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query250 2.2.26 [Sep-21-2011]
A6QP05317 Dehydrogenase/reductase S yes no 0.92 0.725 0.461 3e-52
A0PJE2317 Dehydrogenase/reductase S yes no 0.9 0.709 0.452 1e-50
Q8TC12318 Retinol dehydrogenase 11 no no 0.84 0.660 0.318 2e-21
Q8BYK4316 Retinol dehydrogenase 12 yes no 0.836 0.661 0.312 3e-20
Q9QYF1316 Retinol dehydrogenase 11 no no 0.844 0.667 0.310 5e-20
P59837316 Retinol dehydrogenase 12 no no 0.84 0.664 0.331 8e-20
Q8CEE7334 Retinol dehydrogenase 13 no no 0.872 0.652 0.309 2e-19
Q8N5I4330 Dehydrogenase/reductase S no no 0.836 0.633 0.330 3e-19
Q8NBN7331 Retinol dehydrogenase 13 no no 0.88 0.664 0.306 3e-19
Q96NR8316 Retinol dehydrogenase 12 no no 0.856 0.677 0.324 7e-19
>sp|A6QP05|DHR12_BOVIN Dehydrogenase/reductase SDR family member 12 OS=Bos taurus GN=DHRS12 PE=2 SV=1 Back     alignment and function desciption
 Score =  205 bits (521), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 109/236 (46%), Positives = 144/236 (61%), Gaps = 6/236 (2%)

Query: 1   MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAG 60
           +VCR   + E A + I  ++GN+N+ L + DLS    +  F   F  ++  ++VL+NNAG
Sbjct: 69  LVCRDHSRAEGAKAEIIRESGNQNIFLHIVDLSLPKSVWKFVENFKQEHT-LNVLINNAG 127

Query: 61  VLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHL-TD 119
            + N R +T +G E NFA N LG Y +T +++P+LEK   D RVITVSSGGM    L TD
Sbjct: 128 CMVNKRELTEDGLEKNFATNTLGVYVLTTALIPVLEKEH-DPRVITVSSGGMLVQKLNTD 186

Query: 120 DLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSF 179
           D +    +FDG   YA+NKR QV LTE+W+  +    I F  MHPGW +TPGV  SMP F
Sbjct: 187 DPQSERTAFDGTMVYAQNKRQQVVLTERWARAH--PAIHFSCMHPGWVDTPGVRLSMPGF 244

Query: 180 NERFAGNLRTSEEGADTVLWLALQPKEKL-VSGSFYFDRAEAPKHLKFAATAASHA 234
           + R    LR+  +GADTVLWLAL P      SG F+ DR  AP HL  A T++S A
Sbjct: 245 HARLGARLRSEAQGADTVLWLALAPAATAQPSGCFFQDRKPAPTHLPLARTSSSPA 300




Putative oxidoreductase.
Bos taurus (taxid: 9913)
EC: 1EC: .EC: 1EC: .EC: -EC: .EC: -
>sp|A0PJE2|DHR12_HUMAN Dehydrogenase/reductase SDR family member 12 OS=Homo sapiens GN=DHRS12 PE=1 SV=2 Back     alignment and function description
>sp|Q8TC12|RDH11_HUMAN Retinol dehydrogenase 11 OS=Homo sapiens GN=RDH11 PE=1 SV=2 Back     alignment and function description
>sp|Q8BYK4|RDH12_MOUSE Retinol dehydrogenase 12 OS=Mus musculus GN=Rdh12 PE=2 SV=1 Back     alignment and function description
>sp|Q9QYF1|RDH11_MOUSE Retinol dehydrogenase 11 OS=Mus musculus GN=Rdh11 PE=2 SV=2 Back     alignment and function description
>sp|P59837|RDH12_BOVIN Retinol dehydrogenase 12 OS=Bos taurus GN=RDH12 PE=2 SV=1 Back     alignment and function description
>sp|Q8CEE7|RDH13_MOUSE Retinol dehydrogenase 13 OS=Mus musculus GN=Rdh13 PE=2 SV=1 Back     alignment and function description
>sp|Q8N5I4|DHRSX_HUMAN Dehydrogenase/reductase SDR family member on chromosome X OS=Homo sapiens GN=DHRSX PE=2 SV=2 Back     alignment and function description
>sp|Q8NBN7|RDH13_HUMAN Retinol dehydrogenase 13 OS=Homo sapiens GN=RDH13 PE=1 SV=2 Back     alignment and function description
>sp|Q96NR8|RDH12_HUMAN Retinol dehydrogenase 12 OS=Homo sapiens GN=RDH12 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
388521109342 unknown [Lotus japonicus] 0.992 0.725 0.754 1e-112
225470842343 PREDICTED: dehydrogenase/reductase SDR f 0.996 0.725 0.759 1e-111
388503624342 unknown [Lotus japonicus] 0.992 0.725 0.754 1e-111
147782549343 hypothetical protein VITISV_017613 [Viti 0.996 0.725 0.759 1e-111
363806986344 uncharacterized protein LOC100775215 [Gl 0.992 0.720 0.766 1e-111
255566744322 short-chain dehydrogenase, putative [Ric 0.996 0.773 0.763 1e-110
297809153322 short-chain dehydrogenase/reductase fami 0.996 0.773 0.742 1e-110
224085225322 predicted protein [Populus trichocarpa] 0.996 0.773 0.755 1e-110
118488871341 unknown [Populus trichocarpa x Populus d 0.996 0.730 0.751 1e-109
357497625 366 Dehydrogenase/reductase SDR family membe 0.996 0.680 0.734 1e-109
>gi|388521109|gb|AFK48616.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
 Score =  408 bits (1049), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 187/248 (75%), Positives = 223/248 (89%)

Query: 1   MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAG 60
           +VCR+KE+GE ALS I++KTGN NVHLE+CDLSS+TEIKSFA+RFS KN P+HVLVNNAG
Sbjct: 92  LVCRNKERGEAALSEIQTKTGNRNVHLEICDLSSVTEIKSFASRFSEKNLPLHVLVNNAG 151

Query: 61  VLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDD 120
           ++E NR+ T+EGFELNFAVNVLGTYT+TE MVPLLEKA+PDARVITVSSGGMYT+ LT D
Sbjct: 152 LIEQNRVTTTEGFELNFAVNVLGTYTMTELMVPLLEKASPDARVITVSSGGMYTSPLTKD 211

Query: 121 LEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFN 180
           L+++  +++G+EQYARNKRVQVALTEKW+E Y+ KG+GFYSMHPGW ETPGVAKS+PSF+
Sbjct: 212 LQYSESNYNGVEQYARNKRVQVALTEKWAETYENKGVGFYSMHPGWVETPGVAKSLPSFS 271

Query: 181 ERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIV 240
           +  +G LRTSEEGADTV+WLALQPKEKLVSG+FYFDRAEAPKHL FAAT+ SHA I+ +V
Sbjct: 272 KSLSGKLRTSEEGADTVIWLALQPKEKLVSGAFYFDRAEAPKHLAFAATSGSHALINSVV 331

Query: 241 DVLRSMAN 248
           D L SM +
Sbjct: 332 DSLHSMVS 339




Source: Lotus japonicus

Species: Lotus japonicus

Genus: Lotus

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225470842|ref|XP_002265826.1| PREDICTED: dehydrogenase/reductase SDR family member 12 [Vitis vinifera] gi|296083139|emb|CBI22775.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|388503624|gb|AFK39878.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|147782549|emb|CAN61801.1| hypothetical protein VITISV_017613 [Vitis vinifera] Back     alignment and taxonomy information
>gi|363806986|ref|NP_001242060.1| uncharacterized protein LOC100775215 [Glycine max] gi|255635811|gb|ACU18254.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|255566744|ref|XP_002524356.1| short-chain dehydrogenase, putative [Ricinus communis] gi|223536447|gb|EEF38096.1| short-chain dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297809153|ref|XP_002872460.1| short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata] gi|297318297|gb|EFH48719.1| short-chain dehydrogenase/reductase family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|224085225|ref|XP_002307520.1| predicted protein [Populus trichocarpa] gi|222856969|gb|EEE94516.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|118488871|gb|ABK96245.1| unknown [Populus trichocarpa x Populus deltoides] Back     alignment and taxonomy information
>gi|357497625|ref|XP_003619101.1| Dehydrogenase/reductase SDR family member [Medicago truncatula] gi|355494116|gb|AES75319.1| Dehydrogenase/reductase SDR family member [Medicago truncatula] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query250
TAIR|locus:2118435322 AT4G09750 [Arabidopsis thalian 0.996 0.773 0.734 5e-99
UNIPROTKB|E1BUZ3323 DHRS12 "Uncharacterized protei 0.972 0.752 0.473 1.4e-55
ZFIN|ZDB-GENE-060929-1134318 dhrs12 "dehydrogenase/reductas 0.976 0.767 0.46 3e-53
UNIPROTKB|A0PJE2317 DHRS12 "Dehydrogenase/reductas 0.972 0.766 0.445 3.1e-51
UNIPROTKB|A6QP05317 DHRS12 "Dehydrogenase/reductas 0.972 0.766 0.445 5.1e-51
ZFIN|ZDB-GENE-030131-8104320 flj13639 "flj13639" [Danio rer 0.976 0.762 0.417 4.2e-47
DICTYBASE|DDB_G0288429330 DDB_G0288429 "short-chain dehy 0.976 0.739 0.386 2e-40
FB|FBgn0050495327 CG30495 [Drosophila melanogast 0.872 0.666 0.346 1.1e-30
ZFIN|ZDB-GENE-040801-48291 rdh12l "retinol dehydrogenase 0.848 0.728 0.334 3.5e-27
FB|FBgn0050491331 CG30491 [Drosophila melanogast 0.852 0.643 0.323 6.6e-26
TAIR|locus:2118435 AT4G09750 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 983 (351.1 bits), Expect = 5.0e-99, P = 5.0e-99
 Identities = 183/249 (73%), Positives = 218/249 (87%)

Query:     1 MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAG 60
             MVCR+KE+G+ ALS I++ TGN+NV+LE+CDLSS+ EIKSFA+ F+ K+ PVHVLVNNAG
Sbjct:    72 MVCRNKERGQEALSKIQTSTGNQNVYLEVCDLSSVNEIKSFASSFASKDVPVHVLVNNAG 131

Query:    61 VLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDD 120
             +LEN R  T EGFEL+FAVNVLGTYT+TE M+PLLEKA PDA+VITV+SGGMYT+ LT D
Sbjct:   132 LLENKRTTTPEGFELSFAVNVLGTYTMTELMLPLLEKATPDAKVITVASGGMYTSPLTTD 191

Query:   121 LEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFN 180
             L+F+   FDG+EQYARNKR+QVALTEKW++ YK KGIGFYSMHPGWAETPGVAKS+PSF+
Sbjct:   192 LQFSGEKFDGVEQYARNKRIQVALTEKWADKYKNKGIGFYSMHPGWAETPGVAKSLPSFS 251

Query:   181 ERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEAPKHLKFAATAASHARIDPIV 240
             E FAG LRTSE+GADT++WLALQPKEKLVSG+FYFDRAEAPKHLK A T+ SH  ID ++
Sbjct:   252 ESFAGKLRTSEQGADTIVWLALQPKEKLVSGAFYFDRAEAPKHLKLAGTSKSHDLIDSVI 311

Query:   241 DVLRSMANL 249
             D + SMA L
Sbjct:   312 DSVHSMAAL 320




GO:0000166 "nucleotide binding" evidence=IEA
GO:0005575 "cellular_component" evidence=ND
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
UNIPROTKB|E1BUZ3 DHRS12 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-060929-1134 dhrs12 "dehydrogenase/reductase (SDR family) member 12" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|A0PJE2 DHRS12 "Dehydrogenase/reductase SDR family member 12" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|A6QP05 DHRS12 "Dehydrogenase/reductase SDR family member 12" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-8104 flj13639 "flj13639" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0288429 DDB_G0288429 "short-chain dehydrogenase/reductase (SDR) family protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
FB|FBgn0050495 CG30495 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040801-48 rdh12l "retinol dehydrogenase 12, like" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0050491 CG30491 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
GSVIVG00008975001
SubName- Full=Chromosome undetermined scaffold_213, whole genome shotgun sequence; (343 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00037680001
SubName- Full=Chromosome undetermined scaffold_91, whole genome shotgun sequence; (159 aa)
       0.464

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
cd09808255 cd09808, DHRS-12_like_SDR_c-like, human dehydrogen 3e-83
cd05327269 cd05327, retinol-DH_like_SDR_c_like, retinol dehyd 8e-61
cd09807274 cd09807, retinol-DH_like_SDR_c, retinol dehydrogen 7e-36
PRK06196315 PRK06196, PRK06196, oxidoreductase; Provisional 4e-25
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 5e-24
PRK05854313 PRK05854, PRK05854, short chain dehydrogenase; Pro 6e-21
PRK06197306 PRK06197, PRK06197, short chain dehydrogenase; Pro 2e-20
cd05233234 cd05233, SDR_c, classical (c) SDRs 1e-19
cd09809284 cd09809, human_WWOX_like_SDR_c-like, human WWOX (W 7e-19
cd09810311 cd09810, LPOR_like_SDR_c_like, light-dependent pro 2e-17
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-16
cd05325233 cd05325, carb_red_sniffer_like_SDR_c, carbonyl red 2e-16
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-13
PLN00015308 PLN00015, PLN00015, protochlorophyllide reductase 2e-12
cd05354235 cd05354, SDR_c7, classical (c) SDR, subgroup 7 3e-12
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 2e-10
TIGR01289314 TIGR01289, LPOR, light-dependent protochlorophylli 3e-10
PRK07453322 PRK07453, PRK07453, protochlorophyllide oxidoreduc 9e-10
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 5e-09
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 3e-08
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 3e-08
cd02266186 cd02266, SDR, Short-chain dehydrogenases/reductase 7e-08
cd08951260 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 8e-08
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-08
cd05370228 cd05370, SDR_c2, classical (c) SDR, subgroup 2 1e-07
PRK07454241 PRK07454, PRK07454, short chain dehydrogenase; Pro 1e-07
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 2e-07
cd08941290 cd08941, 3KS_SDR_c, 3-keto steroid reductase, clas 3e-07
cd09805281 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta 3e-07
COG3967245 COG3967, DltE, Short-chain dehydrogenase involved 3e-07
PRK06914280 PRK06914, PRK06914, short chain dehydrogenase; Pro 6e-07
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 6e-07
cd05343250 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, c 7e-07
cd08932223 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like 1e-06
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 2e-06
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 2e-06
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-06
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 3e-06
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 3e-06
PRK12746254 PRK12746, PRK12746, short chain dehydrogenase; Pro 5e-06
cd08942250 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacy 5e-06
cd05337255 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl 7e-06
COG0300265 COG0300, DltE, Short-chain dehydrogenases of vario 8e-06
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 1e-05
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 1e-05
cd05344253 cd05344, BKR_like_SDR_like, putative beta-ketoacyl 1e-05
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 2e-05
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 2e-05
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-05
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 2e-05
PRK07985294 PRK07985, PRK07985, oxidoreductase; Provisional 3e-05
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 3e-05
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 6e-05
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 9e-05
cd05351244 cd05351, XR_like_SDR_c, xylulose reductase-like, c 1e-04
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 1e-04
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 1e-04
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 2e-04
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-04
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 3e-04
PRK12745256 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-prote 3e-04
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 4e-04
PRK06128300 PRK06128, PRK06128, oxidoreductase; Provisional 7e-04
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 9e-04
pfam00106167 pfam00106, adh_short, short chain dehydrogenase 0.001
PRK07666239 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) 0.001
PRK07074257 PRK07074, PRK07074, short chain dehydrogenase; Pro 0.001
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 0.001
TIGR04316250 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxyben 0.001
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 0.002
cd05328250 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid de 0.002
PRK09072263 PRK09072, PRK09072, short chain dehydrogenase; Pro 0.002
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 0.002
PRK13394262 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenas 0.003
PRK12859256 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-prote 0.003
cd05331244 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydroz 0.003
PRK08264238 PRK08264, PRK08264, short chain dehydrogenase; Val 0.003
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 0.004
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 0.004
>gnl|CDD|187668 cd09808, DHRS-12_like_SDR_c-like, human dehydrogenase/reductase SDR family member (DHRS)-12/FLJ13639-like, classical (c)-like SDRs Back     alignment and domain information
 Score =  249 bits (636), Expect = 3e-83
 Identities = 108/229 (47%), Positives = 145/229 (63%), Gaps = 5/229 (2%)

Query: 1   MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAG 60
           MVCR++ + E A   I +++GN+N+ L + D+S   ++  F   F  + K +HVL+NNAG
Sbjct: 30  MVCRNQTRAEEARKEIETESGNQNIFLHIVDMSDPKQVWEFVEEFKEEGKKLHVLINNAG 89

Query: 61  VLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHL-TD 119
            + N R +T +G E NFA N LGTY +T  ++P+LEK   D RVITVSSGGM    L T+
Sbjct: 90  CMVNKRELTEDGLEKNFATNTLGTYILTTHLIPVLEK-EEDPRVITVSSGGMLVQKLNTN 148

Query: 120 DLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSF 179
           +L+    +FDG   YA+NKR QV +TE+W++ + E  I F  MHPGWA+TP V  SMP F
Sbjct: 149 NLQSERTAFDGTMVYAQNKRQQVIMTEQWAKKHPE--IHFSVMHPGWADTPAVRNSMPDF 206

Query: 180 NERFAGNLRTSEEGADTVLWLAL-QPKEKLVSGSFYFDRAEAPKHLKFA 227
           + RF   LR+ E+GADTV+WLAL     K  SG FY DR     HL  A
Sbjct: 207 HARFKDRLRSEEQGADTVVWLALSSAAAKAPSGRFYQDRKPVSTHLPLA 255


Classical SDR-like subgroup containing human DHRS-12/FLJ13639, the 36K protein of zebrafish CNS myelin, and related proteins. DHRS-12/FLJ13639 is expressed in neurons and oligodendrocytes in the human cerebral cortex. Proteins in this subgroup share the glycine-rich NAD-binding motif of the classical SDRs, have a partial match to the canonical active site tetrad, but lack the typical active site Ser. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, human 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 255

>gnl|CDD|212492 cd05327, retinol-DH_like_SDR_c_like, retinol dehydrogenase (retinol-DH), Light dependent Protochlorophyllide (Pchlide) OxidoReductase (LPOR) and related proteins, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212495 cd09807, retinol-DH_like_SDR_c, retinol dehydrogenases (retinol-DHs), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235736 PRK06196, PRK06196, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235627 PRK05854, PRK05854, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235737 PRK06197, PRK06197, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187669 cd09809, human_WWOX_like_SDR_c-like, human WWOX (WW domain-containing oxidoreductase)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|187670 cd09810, LPOR_like_SDR_c_like, light-dependent protochlorophyllide reductase (LPOR)-like, classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|187586 cd05325, carb_red_sniffer_like_SDR_c, carbonyl reductase sniffer-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|177654 PLN00015, PLN00015, protochlorophyllide reductase Back     alignment and domain information
>gnl|CDD|187612 cd05354, SDR_c7, classical (c) SDR, subgroup 7 Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|200089 TIGR01289, LPOR, light-dependent protochlorophyllide reductase Back     alignment and domain information
>gnl|CDD|180983 PRK07453, PRK07453, protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187535 cd02266, SDR, Short-chain dehydrogenases/reductases (SDR) Back     alignment and domain information
>gnl|CDD|187654 cd08951, DR_C-13_KR_SDR_c_like, daunorubicin C-13 ketoreductase (KR), classical (c)-like SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187628 cd05370, SDR_c2, classical (c) SDR, subgroup 2 Back     alignment and domain information
>gnl|CDD|180984 PRK07454, PRK07454, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187645 cd08941, 3KS_SDR_c, 3-keto steroid reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187665 cd09805, type2_17beta_HSD-like_SDR_c, human 17beta-hydroxysteroid dehydrogenase type 2 (type 2 17beta-HSD)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|226476 COG3967, DltE, Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|180744 PRK06914, PRK06914, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187601 cd05343, Mgc4172-like_SDR_c, human Mgc4172-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|212493 cd08932, HetN_like_SDR_c, HetN oxidoreductase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|183718 PRK12746, PRK12746, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187646 cd08942, RhlG_SDR_c, RhlG and related beta-ketoacyl reductases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187596 cd05337, BKR_1_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 1, classical (c) SDR Back     alignment and domain information
>gnl|CDD|223377 COG0300, DltE, Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187602 cd05344, BKR_like_SDR_like, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR)-like, SDR Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181188 PRK07985, PRK07985, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187609 cd05351, XR_like_SDR_c, xylulose reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|237188 PRK12745, PRK12745, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180413 PRK06128, PRK06128, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215720 pfam00106, adh_short, short chain dehydrogenase Back     alignment and domain information
>gnl|CDD|236074 PRK07666, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180823 PRK07074, PRK07074, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|213929 TIGR04316, dhbA_paeA, 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187589 cd05328, 3alpha_HSD_SDR_c, alpha hydroxysteroid dehydrogenase (3alpha_HSD), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236372 PRK09072, PRK09072, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|184025 PRK13394, PRK13394, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183797 PRK12859, PRK12859, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187592 cd05331, DH-DHB-DH_SDR_c, 2,3 dihydro-2,3 dihydrozybenzoate dehydrogenases, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|181335 PRK08264, PRK08264, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 250
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 100.0
KOG1208314 consensus Dehydrogenases with different specificit 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 100.0
PLN00015308 protochlorophyllide reductase 100.0
COG0300265 DltE Short-chain dehydrogenases of various substra 100.0
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05854313 short chain dehydrogenase; Provisional 100.0
PRK06196315 oxidoreductase; Provisional 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07063260 short chain dehydrogenase; Provisional 100.0
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK08589272 short chain dehydrogenase; Validated 100.0
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK05867253 short chain dehydrogenase; Provisional 100.0
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07062265 short chain dehydrogenase; Provisional 100.0
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 100.0
PRK08303305 short chain dehydrogenase; Provisional 100.0
PRK07791286 short chain dehydrogenase; Provisional 100.0
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 100.0
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK07478254 short chain dehydrogenase; Provisional 100.0
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08340259 glucose-1-dehydrogenase; Provisional 100.0
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 100.0
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK06197306 short chain dehydrogenase; Provisional 100.0
KOG0725270 consensus Reductases with broad range of substrate 100.0
PRK06114254 short chain dehydrogenase; Provisional 100.0
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 100.0
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.98
PRK08277278 D-mannonate oxidoreductase; Provisional 99.98
PRK08265261 short chain dehydrogenase; Provisional 99.98
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.98
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.97
PRK06940275 short chain dehydrogenase; Provisional 99.97
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.97
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.97
PRK12747252 short chain dehydrogenase; Provisional 99.97
PRK07831262 short chain dehydrogenase; Provisional 99.97
PRK08643256 acetoin reductase; Validated 99.97
PRK06172253 short chain dehydrogenase; Provisional 99.97
PRK05599246 hypothetical protein; Provisional 99.97
PRK07035252 short chain dehydrogenase; Provisional 99.97
PRK12743256 oxidoreductase; Provisional 99.97
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.97
PRK09242257 tropinone reductase; Provisional 99.97
PRK07677252 short chain dehydrogenase; Provisional 99.97
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.97
PRK07985294 oxidoreductase; Provisional 99.97
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.97
PRK08936261 glucose-1-dehydrogenase; Provisional 99.97
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.97
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.97
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.97
PRK06128300 oxidoreductase; Provisional 99.97
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.97
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.97
PRK06125259 short chain dehydrogenase; Provisional 99.97
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.97
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.97
PRK06139330 short chain dehydrogenase; Provisional 99.97
PRK06398258 aldose dehydrogenase; Validated 99.97
PRK06484520 short chain dehydrogenase; Validated 99.97
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.97
PLN02253280 xanthoxin dehydrogenase 99.97
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 99.96
PRK07067257 sorbitol dehydrogenase; Provisional 99.96
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.96
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.96
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.96
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.96
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
PRK08226263 short chain dehydrogenase; Provisional 99.96
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.96
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK06841255 short chain dehydrogenase; Provisional 99.96
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.96
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.96
PRK07856252 short chain dehydrogenase; Provisional 99.96
PRK06949258 short chain dehydrogenase; Provisional 99.96
PRK05872296 short chain dehydrogenase; Provisional 99.96
PRK07069251 short chain dehydrogenase; Validated 99.96
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.96
PRK06523260 short chain dehydrogenase; Provisional 99.96
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.96
PRK12939250 short chain dehydrogenase; Provisional 99.96
PRK08862227 short chain dehydrogenase; Provisional 99.96
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.96
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.96
PRK08278273 short chain dehydrogenase; Provisional 99.96
PRK06947248 glucose-1-dehydrogenase; Provisional 99.96
PRK05876275 short chain dehydrogenase; Provisional 99.96
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.96
PRK07890258 short chain dehydrogenase; Provisional 99.96
PRK06484 520 short chain dehydrogenase; Validated 99.96
PRK05884223 short chain dehydrogenase; Provisional 99.96
PRK09186256 flagellin modification protein A; Provisional 99.96
PRK06483236 dihydromonapterin reductase; Provisional 99.96
PRK08628258 short chain dehydrogenase; Provisional 99.96
PRK12937245 short chain dehydrogenase; Provisional 99.96
PRK05717255 oxidoreductase; Validated 99.96
PRK07109334 short chain dehydrogenase; Provisional 99.96
PRK06701290 short chain dehydrogenase; Provisional 99.96
PRK07814263 short chain dehydrogenase; Provisional 99.95
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.95
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.95
PRK07576264 short chain dehydrogenase; Provisional 99.95
PRK05855582 short chain dehydrogenase; Validated 99.95
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.95
PRK06500249 short chain dehydrogenase; Provisional 99.95
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.95
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.95
PRK07454241 short chain dehydrogenase; Provisional 99.95
PRK06138252 short chain dehydrogenase; Provisional 99.95
PRK12744257 short chain dehydrogenase; Provisional 99.95
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.95
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.95
PRK06123248 short chain dehydrogenase; Provisional 99.95
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.95
PRK06198260 short chain dehydrogenase; Provisional 99.95
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.95
PRK05875276 short chain dehydrogenase; Provisional 99.95
PRK12742237 oxidoreductase; Provisional 99.95
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.95
PRK06057255 short chain dehydrogenase; Provisional 99.95
PRK08703239 short chain dehydrogenase; Provisional 99.95
PRK07832272 short chain dehydrogenase; Provisional 99.95
PRK05650270 short chain dehydrogenase; Provisional 99.95
PRK07774250 short chain dehydrogenase; Provisional 99.95
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.94
PLN02780320 ketoreductase/ oxidoreductase 99.94
PRK07825273 short chain dehydrogenase; Provisional 99.94
PRK09134258 short chain dehydrogenase; Provisional 99.94
PRK07024257 short chain dehydrogenase; Provisional 99.94
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.94
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.94
PRK12827249 short chain dehydrogenase; Provisional 99.94
PRK05866293 short chain dehydrogenase; Provisional 99.94
PRK12746254 short chain dehydrogenase; Provisional 99.94
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.94
PRK06182273 short chain dehydrogenase; Validated 99.94
PRK07904253 short chain dehydrogenase; Provisional 99.94
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.94
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.94
PRK10538248 malonic semialdehyde reductase; Provisional 99.94
PRK07074257 short chain dehydrogenase; Provisional 99.94
PRK05993277 short chain dehydrogenase; Provisional 99.94
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.94
PRK09009235 C factor cell-cell signaling protein; Provisional 99.94
PRK08263275 short chain dehydrogenase; Provisional 99.94
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.93
PRK09072263 short chain dehydrogenase; Provisional 99.93
PRK07060245 short chain dehydrogenase; Provisional 99.93
PRK08251248 short chain dehydrogenase; Provisional 99.93
PRK06914280 short chain dehydrogenase; Provisional 99.93
PRK06180277 short chain dehydrogenase; Provisional 99.93
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.93
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.93
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK07577234 short chain dehydrogenase; Provisional 99.93
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.93
PRK08267260 short chain dehydrogenase; Provisional 99.93
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK07775274 short chain dehydrogenase; Provisional 99.93
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK07041230 short chain dehydrogenase; Provisional 99.92
PRK06194287 hypothetical protein; Provisional 99.92
PRK08324681 short chain dehydrogenase; Validated 99.92
PRK12828239 short chain dehydrogenase; Provisional 99.92
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.92
PRK06181263 short chain dehydrogenase; Provisional 99.92
PRK12829264 short chain dehydrogenase; Provisional 99.92
PRK06924251 short chain dehydrogenase; Provisional 99.92
PRK07102243 short chain dehydrogenase; Provisional 99.92
PRK07806248 short chain dehydrogenase; Provisional 99.92
PRK07201657 short chain dehydrogenase; Provisional 99.92
PRK06179270 short chain dehydrogenase; Provisional 99.92
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 99.92
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK05693274 short chain dehydrogenase; Provisional 99.91
PRK07578199 short chain dehydrogenase; Provisional 99.91
PRK07326237 short chain dehydrogenase; Provisional 99.91
PRK09135249 pteridine reductase; Provisional 99.9
PRK06482276 short chain dehydrogenase; Provisional 99.9
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.9
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.9
PRK06101240 short chain dehydrogenase; Provisional 99.89
COG1028251 FabG Dehydrogenases with different specificities ( 99.89
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.89
PRK08177225 short chain dehydrogenase; Provisional 99.89
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 99.88
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.88
PRK07023243 short chain dehydrogenase; Provisional 99.88
PRK09291257 short chain dehydrogenase; Provisional 99.86
PRK08264238 short chain dehydrogenase; Validated 99.86
PRK08017256 oxidoreductase; Provisional 99.85
PRK06953222 short chain dehydrogenase; Provisional 99.85
PRK08219227 short chain dehydrogenase; Provisional 99.82
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 99.82
PRK12367245 short chain dehydrogenase; Provisional 99.8
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.78
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.71
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.68
PLN03209 576 translocon at the inner envelope of chloroplast su 99.6
TIGR03589324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.6
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.57
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.57
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.55
TIGR02622349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.5
PLN02650351 dihydroflavonol-4-reductase 99.43
COG1088340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.43
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.4
PRK10217355 dTDP-glucose 4,6-dehydratase; Provisional 99.39
PLN02583297 cinnamoyl-CoA reductase 99.39
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.38
TIGR01181317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.34
PLN02214342 cinnamoyl-CoA reductase 99.34
PLN02896353 cinnamyl-alcohol dehydrogenase 99.34
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.34
PLN02653340 GDP-mannose 4,6-dehydratase 99.34
PRK10084352 dTDP-glucose 4,6 dehydratase; Provisional 99.3
PRK06720169 hypothetical protein; Provisional 99.25
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.25
PLN00198338 anthocyanidin reductase; Provisional 99.24
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 99.24
TIGR01472343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.21
PLN02572 442 UDP-sulfoquinovose synthase 99.19
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 99.19
PLN02240352 UDP-glucose 4-epimerase 99.19
PRK15181348 Vi polysaccharide biosynthesis protein TviC; Provi 99.18
TIGR01179328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.17
PRK10675338 UDP-galactose-4-epimerase; Provisional 99.15
COG1086588 Predicted nucleoside-diphosphate sugar epimerases 99.14
TIGR03466328 HpnA hopanoid-associated sugar epimerase. The sequ 99.08
PLN02686367 cinnamoyl-CoA reductase 99.07
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 99.07
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 99.06
PRK11908347 NAD-dependent epimerase/dehydratase family protein 99.0
TIGR01746367 Thioester-redct thioester reductase domain. It has 99.0
TIGR01214287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.99
COG1087329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 98.96
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 98.94
PLN02260 668 probable rhamnose biosynthetic enzyme 98.92
TIGR02197314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.91
PRK11150308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.9
PRK08125660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.88
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.85
PLN02427386 UDP-apiose/xylose synthase 98.84
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.79
PRK09987299 dTDP-4-dehydrorhamnose reductase; Provisional 98.75
KOG0747331 consensus Putative NAD+-dependent epimerases [Carb 98.73
PLN02725306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.72
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.67
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.64
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.59
PLN02695370 GDP-D-mannose-3',5'-epimerase 98.58
PLN02206442 UDP-glucuronate decarboxylase 98.56
KOG1371343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 98.52
PLN02166436 dTDP-glucose 4,6-dehydratase 98.46
PRK07201 657 short chain dehydrogenase; Provisional 98.42
PLN02996 491 fatty acyl-CoA reductase 98.41
KOG1430361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 98.39
CHL00194317 ycf39 Ycf39; Provisional 98.37
PLN02260668 probable rhamnose biosynthetic enzyme 98.37
PLN02778298 3,5-epimerase/4-reductase 98.36
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 98.33
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.24
COG1089345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.2
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.16
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 98.13
PRK05865 854 hypothetical protein; Provisional 98.07
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 98.0
PRK08309177 short chain dehydrogenase; Provisional 97.72
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 97.64
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 97.52
PLN02503 605 fatty acyl-CoA reductase 2 97.48
COG4982 866 3-oxoacyl-[acyl-carrier protein] 97.28
KOG1431315 consensus GDP-L-fucose synthetase [Carbohydrate tr 97.09
KOG2733 423 consensus Uncharacterized membrane protein [Functi 96.91
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 96.69
PLN00016378 RNA-binding protein; Provisional 96.68
KOG2774366 consensus NAD dependent epimerase [General functio 96.27
PRK12320 699 hypothetical protein; Provisional 96.06
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 95.84
KOG1429350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 95.4
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.3
KOG1372376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 95.23
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 95.05
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 94.11
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 93.96
KOG2865391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 91.6
PLN00106323 malate dehydrogenase 91.36
PRK06732229 phosphopantothenate--cysteine ligase; Validated 89.81
PTZ00325321 malate dehydrogenase; Provisional 89.54
KOG4039238 consensus Serine/threonine kinase TIP30/CC3 [Signa 88.76
COG2910211 Putative NADH-flavin reductase [General function p 88.74
PRK12548289 shikimate 5-dehydrogenase; Provisional 87.89
KOG1203411 consensus Predicted dehydrogenase [Carbohydrate tr 86.94
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 84.89
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 83.95
COG3268 382 Uncharacterized conserved protein [Function unknow 81.06
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 80.92
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 80.71
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=1.5e-37  Score=227.88  Aligned_cols=204  Identities=21%  Similarity=0.239  Sum_probs=180.3

Q ss_pred             CcCCHHHHHHHHHHHHhhcCCCceEEEeccCCCHHHHHHHHHHHhhcCCCceEEEeccccCCCCC--CCCcchhhhhhhh
Q 025633            2 VCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNR--LITSEGFELNFAV   79 (250)
Q Consensus         2 ~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dls~~~~v~~~~~~~~~~~g~id~lv~~ag~~~~~~--~~~~~~~~~~~~~   79 (250)
                      ++++.+.+++++..|...   .....+.||++++++++..+++..+.+|++++||||||+.....  ....++|+..+.+
T Consensus        44 ~dl~~~~A~ata~~L~g~---~~h~aF~~DVS~a~~v~~~l~e~~k~~g~psvlVncAGItrD~~Llrmkq~qwd~vi~v  120 (256)
T KOG1200|consen   44 ADLDSAAAEATAGDLGGY---GDHSAFSCDVSKAHDVQNTLEEMEKSLGTPSVLVNCAGITRDGLLLRMKQEQWDSVIAV  120 (256)
T ss_pred             eecchhhHHHHHhhcCCC---CccceeeeccCcHHHHHHHHHHHHHhcCCCcEEEEcCccccccceeeccHHHHHHHHHh
Confidence            355666777777777543   35788999999999999999999999999999999999998774  5688999999999


Q ss_pred             hhhhHHHHHHHhHHHHhhhC-CCCEEEEEecCcccccccCCccccCCCCCCchhHHHHHHHHHHHHHHHHHHHhccCCeE
Q 025633           80 NVLGTYTITESMVPLLEKAA-PDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIG  158 (250)
Q Consensus        80 n~~~~~~l~~~~~~~l~~~~-~~~~iv~vss~~~~~~~~~~~~~~~~~~~~~~~~Y~~sK~a~~~~~~~la~e~~~~~i~  158 (250)
                      |++|.|+..|++...|...+ .+.+||++||+.+..            +..++..|+++|.++.+|+|+.|+|++++|||
T Consensus       121 NL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGki------------GN~GQtnYAAsK~GvIgftktaArEla~knIr  188 (256)
T KOG1200|consen  121 NLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKI------------GNFGQTNYAASKGGVIGFTKTAARELARKNIR  188 (256)
T ss_pred             hchhhHHHHHHHHHHHHHhcCCCceEEeehhhhccc------------ccccchhhhhhcCceeeeeHHHHHHHhhcCce
Confidence            99999999999999855443 445999999999998            67788899999999999999999999999999


Q ss_pred             EEEecCccccCCcccccccchHHH-----hhccCCCHHHHHhHhhHhhccCCCCCCCceeeecCCCc
Q 025633          159 FYSMHPGWAETPGVAKSMPSFNER-----FAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEA  220 (250)
Q Consensus       159 v~~v~PG~v~t~~~~~~~~~~~~~-----~~~~~~~p~~~a~~~~~l~~~~~~~~~~g~~~~~~~~~  220 (250)
                      ||+|.||++.|||.....++..+.     +++++..+||+|+.++||+++.+.|.+|..+-++||..
T Consensus       189 vN~VlPGFI~tpMT~~mp~~v~~ki~~~iPmgr~G~~EevA~~V~fLAS~~ssYiTG~t~evtGGl~  255 (256)
T KOG1200|consen  189 VNVVLPGFIATPMTEAMPPKVLDKILGMIPMGRLGEAEEVANLVLFLASDASSYITGTTLEVTGGLA  255 (256)
T ss_pred             EeEeccccccChhhhhcCHHHHHHHHccCCccccCCHHHHHHHHHHHhccccccccceeEEEecccc
Confidence            999999999999998887776544     47889999999999999999999999999999999853



>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>KOG2774 consensus NAD dependent epimerase [General function prediction only] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PLN00106 malate dehydrogenase Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PTZ00325 malate dehydrogenase; Provisional Back     alignment and domain information
>KOG4039 consensus Serine/threonine kinase TIP30/CC3 [Signal transduction mechanisms] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
3rd5_A291 Crystal Structure Of A Putative Uncharacterized Pro 1e-10
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 1e-06
3rku_A287 Substrate Fingerprint And The Structure Of Nadp+ De 1e-05
3rj5_A254 Structure Of Alcohol Dehydrogenase From Drosophila 2e-04
3r3s_A294 Structure Of The Ygha Oxidoreductase From Salmonell 3e-04
4eso_A255 Crystal Structure Of A Putative Oxidoreductase Prot 4e-04
3vc7_A254 Crystal Structure Of A Putative Oxidoreductase From 4e-04
1n5d_A288 Crystal Structure Of Porcine Testicular Carbonyl Re 5e-04
1a4u_A254 Alcohol Dehydrogenase From Drosophila Lebanonensis 6e-04
1sny_A267 Carbonyl Reductase Sniffer Of D. Melanogaster Lengt 7e-04
1vl8_A267 Crystal Structure Of Gluconate 5-dehydrogenase (tm0 7e-04
1yb1_A272 Crystal Structure Of Human 17-Beta-Hydroxysteroid D 7e-04
4fn4_A254 Short-chain Nad(h)-dependent Dehydrogenase/reductas 7e-04
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 7e-04
>pdb|3RD5|A Chain A, Crystal Structure Of A Putative Uncharacterized Protein From Mycobacterium Paratuberculosis Length = 291 Back     alignment and structure

Iteration: 1

Score = 63.2 bits (152), Expect = 1e-10, Method: Compositional matrix adjust. Identities = 50/173 (28%), Positives = 79/173 (45%), Gaps = 19/173 (10%) Query: 1 MVCRSKEKGETALSAIRSKTGNENVH-LELCDLSSITEIKSFANRFSLKNKPVHVLVNNA 59 M R KGE +A R+ G V L+L DLSS+ RF+ VL+NNA Sbjct: 45 MAVRDTRKGE---AAARTMAGQVEVRELDLQDLSSV-------RRFADGVSGADVLINNA 94 Query: 60 GVLENNRLITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLT- 118 G++ +T +GFE N LG + +T ++P L RV+TVSS + + Sbjct: 95 GIMAVPYALTVDGFESQIGTNHLGHFALTNLLLPRLTD-----RVVTVSSMAHWPGRINL 149 Query: 119 DDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIGFYSM--HPGWAET 169 +DL + S + Y+++K + T + G ++ HPG++ T Sbjct: 150 EDLNWRSRRYSPWLAYSQSKLANLLFTSELQRRLTAAGSPLRALAAHPGYSHT 202
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|3RKU|A Chain A, Substrate Fingerprint And The Structure Of Nadp+ Dependent Serine Dehydrogenase From Saccharomyces Cerevisiae Complexed With Nadp+ Length = 287 Back     alignment and structure
>pdb|3RJ5|A Chain A, Structure Of Alcohol Dehydrogenase From Drosophila Lebanonesis T114v Mutant Complexed With Nad+ Length = 254 Back     alignment and structure
>pdb|3R3S|A Chain A, Structure Of The Ygha Oxidoreductase From Salmonella Enterica Length = 294 Back     alignment and structure
>pdb|4ESO|A Chain A, Crystal Structure Of A Putative Oxidoreductase Protein From Sinorhizobium Meliloti 1021 In Complex With Nadp Length = 255 Back     alignment and structure
>pdb|3VC7|A Chain A, Crystal Structure Of A Putative Oxidoreductase From Sinorhizobium Meliloti 1021 Length = 254 Back     alignment and structure
>pdb|1N5D|A Chain A, Crystal Structure Of Porcine Testicular Carbonyl Reductase 20beta-Hydroxysteroid Dehydrogenase Length = 288 Back     alignment and structure
>pdb|1A4U|A Chain A, Alcohol Dehydrogenase From Drosophila Lebanonensis Length = 254 Back     alignment and structure
>pdb|1SNY|A Chain A, Carbonyl Reductase Sniffer Of D. Melanogaster Length = 267 Back     alignment and structure
>pdb|1VL8|A Chain A, Crystal Structure Of Gluconate 5-dehydrogenase (tm0441) From Thermotoga Maritima At 2.07 A Resolution Length = 267 Back     alignment and structure
>pdb|1YB1|A Chain A, Crystal Structure Of Human 17-Beta-Hydroxysteroid Dehydrogenase Type Xi Length = 272 Back     alignment and structure
>pdb|4FN4|A Chain A, Short-chain Nad(h)-dependent Dehydrogenase/reductase From Sulfolobus Acidocaldarius Length = 254 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query250
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 3e-40
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 6e-37
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 5e-31
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 6e-23
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 5e-22
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 2e-14
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 4e-14
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 8e-13
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 1e-12
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 2e-12
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 2e-12
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 2e-12
4eso_A255 Putative oxidoreductase; NADP, structural genomics 2e-12
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 3e-12
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 4e-12
1ooe_A236 Dihydropteridine reductase; structural genomics, P 7e-12
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 8e-12
3e03_A274 Short chain dehydrogenase; structural genomics, PS 2e-11
3tjr_A301 Short chain dehydrogenase; structural genomics, se 2e-11
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 7e-11
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 1e-10
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 2e-10
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 5e-10
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 5e-10
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 1e-09
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 2e-09
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 6e-09
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 7e-09
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 8e-09
1spx_A278 Short-chain reductase family member (5L265); paral 9e-09
3imf_A257 Short chain dehydrogenase; structural genomics, in 1e-08
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 1e-08
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 1e-08
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 2e-08
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 2e-08
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 2e-08
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 2e-08
1xhl_A297 Short-chain dehydrogenase/reductase family member 3e-08
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 4e-08
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 5e-08
4e4y_A244 Short chain dehydrogenase family protein; structur 5e-08
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 5e-08
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 5e-08
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 6e-08
1nff_A260 Putative oxidoreductase RV2002; directed evolution 7e-08
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 8e-08
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 8e-08
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 9e-08
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 9e-08
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 1e-07
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 1e-07
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 1e-07
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 2e-07
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 2e-07
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 2e-07
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 2e-07
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 2e-07
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-07
3edm_A259 Short chain dehydrogenase; structural genomics, ox 3e-07
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-07
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 3e-07
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 3e-07
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 3e-07
1xkq_A280 Short-chain reductase family member (5D234); parra 4e-07
3tox_A280 Short chain dehydrogenase; structural genomics, PS 4e-07
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 4e-07
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 5e-07
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 7e-07
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 7e-07
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 7e-07
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 8e-07
3gem_A260 Short chain dehydrogenase; structural genomics, AP 8e-07
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 8e-07
3tsc_A277 Putative oxidoreductase; structural genomics, seat 1e-06
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 1e-06
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 1e-06
4dqx_A277 Probable oxidoreductase protein; structural genomi 1e-06
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 1e-06
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 2e-06
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 2e-06
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 2e-06
1xq1_A266 Putative tropinone reducatse; structural genomics, 3e-06
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 3e-06
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 3e-06
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 3e-06
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 4e-06
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 4e-06
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 5e-06
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 6e-06
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 6e-06
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 7e-06
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 7e-06
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 7e-06
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 9e-06
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 9e-06
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 9e-06
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 9e-06
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 1e-05
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 1e-05
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 1e-05
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 1e-05
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 1e-05
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 2e-05
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 2e-05
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 2e-05
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 2e-05
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 2e-05
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 3e-05
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 3e-05
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 4e-05
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 4e-05
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 5e-05
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 5e-05
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 1e-04
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 5e-05
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 6e-05
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 6e-05
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 6e-05
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 7e-05
3rih_A293 Short chain dehydrogenase or reductase; structural 7e-05
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 7e-05
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 9e-05
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 9e-05
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 1e-04
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 1e-04
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 1e-04
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 1e-04
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 1e-04
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 1e-04
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-04
3qlj_A322 Short chain dehydrogenase; structural genomics, se 1e-04
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 1e-04
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 2e-04
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 2e-04
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 3e-04
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 3e-04
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 4e-04
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 4e-04
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 5e-04
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 6e-04
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 6e-04
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 8e-04
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
 Score =  139 bits (351), Expect = 3e-40
 Identities = 53/259 (20%), Positives = 91/259 (35%), Gaps = 55/259 (21%)

Query: 1   MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAG 60
           +  R   +G+ A+  ++++  +        D+  +  I++  +    +   + VLVNNAG
Sbjct: 34  LTARDVTRGQAAVQQLQAEGLS--PRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAG 91

Query: 61  VLENNRLITS--EGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSS--GGMYTAH 116
           +       T      E+    N  GT  +   ++PL+    P  RV+ VSS         
Sbjct: 92  IAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLI---KPQGRVVNVSSIMSVRALKS 148

Query: 117 LTDDLEFNSGSFDGMEQ---------------------------YARNKRVQVALT---- 145
            + +L+    S    E+                           Y   K     L+    
Sbjct: 149 CSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHA 208

Query: 146 EKWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGN--LRTSEEGADTVLWLALQ 203
            K SE  K   I   +  PGW  T              AG    ++ EEGA+T ++LAL 
Sbjct: 209 RKLSEQRKGDKILLNACCPGWVRT------------DMAGPKATKSPEEGAETPVYLALL 256

Query: 204 PKE-KLVSGSFYFDRAEAP 221
           P + +   G F  ++    
Sbjct: 257 PPDAEGPHGQFVSEKRVEQ 275


>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Length = 291 Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} Length = 311 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Length = 327 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3tsc_A277 Putative oxidoreductase; structural genomics, seat 100.0
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 100.0
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 100.0
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 100.0
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 100.0
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 100.0
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 100.0
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 100.0
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 100.0
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 100.0
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 100.0
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 100.0
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 100.0
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 100.0
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 100.0
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
3cxt_A291 Dehydrogenase with different specificities; rossma 100.0
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 100.0
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 100.0
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 100.0
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 100.0
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 100.0
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 100.0
3edm_A259 Short chain dehydrogenase; structural genomics, ox 100.0
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 100.0
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 100.0
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 100.0
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 100.0
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 100.0
3e03_A274 Short chain dehydrogenase; structural genomics, PS 100.0
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 100.0
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 100.0
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 100.0
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 100.0
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 100.0
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 100.0
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 100.0
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 100.0
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 100.0
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 100.0
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 100.0
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 100.0
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 100.0
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 100.0
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 100.0
1xhl_A297 Short-chain dehydrogenase/reductase family member 100.0
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 100.0
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 100.0
1xkq_A280 Short-chain reductase family member (5D234); parra 100.0
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 100.0
3qlj_A322 Short chain dehydrogenase; structural genomics, se 100.0
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 100.0
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 100.0
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 100.0
1nff_A260 Putative oxidoreductase RV2002; directed evolution 100.0
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 100.0
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 100.0
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 100.0
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 100.0
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 100.0
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 100.0
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 100.0
3gem_A260 Short chain dehydrogenase; structural genomics, AP 100.0
1spx_A278 Short-chain reductase family member (5L265); paral 100.0
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 100.0
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 100.0
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 100.0
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 100.0
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 100.0
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 100.0
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 100.0
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 100.0
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 100.0
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 100.0
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 100.0
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 100.0
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 100.0
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 100.0
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 100.0
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 100.0
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 100.0
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 100.0
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 100.0
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 100.0
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 100.0
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 100.0
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 100.0
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.98
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.98
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.98
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.98
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.98
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.98
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.98
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.98
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.98
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.98
4e4y_A244 Short chain dehydrogenase family protein; structur 99.97
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.97
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.97
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.97
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.97
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.97
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.97
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.97
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.97
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.97
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.97
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.97
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.97
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.97
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.97
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.97
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.97
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.97
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.97
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.97
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.97
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.97
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.97
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.97
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.97
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.97
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.97
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.97
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.97
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.97
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.96
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.96
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.96
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.96
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.96
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.96
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.96
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.96
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.96
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.96
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.96
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.96
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.96
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.96
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.96
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.96
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.96
1jtv_A327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.96
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.96
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.96
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.96
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.96
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.95
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.95
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.95
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.93
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.93
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.92
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.92
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.91
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.91
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.9
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.86
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.85
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.85
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.82
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.8
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.78
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.73
3enk_A341 UDP-glucose 4-epimerase; seattle structural genomi 99.69
1kew_A361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.68
2pk3_A321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.68
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.67
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.67
2z1m_A345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.66
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.66
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.65
2hun_A336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.64
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.62
4egb_A346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.62
1rkx_A357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.62
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.6
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.6
1oc2_A348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.6
1orr_A347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.6
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.6
1sb8_A352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.59
1r6d_A337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.59
1xq6_A253 Unknown protein; structural genomics, protein stru 99.59
2pzm_A330 Putative nucleotide sugar epimerase/ dehydratase; 99.59
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.59
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.59
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.59
1i24_A404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.58
3ehe_A313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.56
2p5y_A311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.56
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.55
1ek6_A348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.55
2c20_A330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.53
4f6c_A427 AUSA reductase domain protein; thioester reductase 99.53
3ruf_A351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.53
3sxp_A362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.53
3ko8_A312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.53
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.53
2c29_D337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.52
1n7h_A381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.52
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 99.51
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 99.5
2hrz_A342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.5
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.5
1db3_A372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.5
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.49
2x6t_A357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.49
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.48
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.46
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.46
2yy7_A312 L-threonine dehydrogenase; thermolabIle, flavobact 99.46
1rpn_A335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.46
1t2a_A375 GDP-mannose 4,6 dehydratase; structural genomics c 99.46
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.45
3slg_A372 PBGP3 protein; structural genomics, seattle struct 99.44
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.44
2q1w_A333 Putative nucleotide sugar epimerase/ dehydratase; 99.44
1udb_A338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.43
2bll_A345 Protein YFBG; decarboxylase, short chain dehydroge 99.43
3ajr_A317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.42
2q1s_A377 Putative nucleotide sugar epimerase/ dehydratase; 99.41
1eq2_A310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.41
4b8w_A319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.4
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.39
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.37
1n2s_A299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.35
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.34
1z7e_A660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.34
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.33
4dqv_A478 Probable peptide synthetase NRP (peptide synthase; 99.33
2rh8_A338 Anthocyanidin reductase; flavonoids, rossmann fold 99.33
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.31
2b69_A343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.28
4f6l_B508 AUSA reductase domain protein; thioester reductase 99.27
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.21
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 99.2
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 99.17
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 99.16
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.07
3ius_A286 Uncharacterized conserved protein; APC63810, silic 99.03
2wm3_A299 NMRA-like family domain containing protein 1; unkn 98.95
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 98.83
1xgk_A352 Nitrogen metabolite repression regulator NMRA; ros 98.82
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 98.8
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.79
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 98.76
2v6g_A364 Progesterone 5-beta-reductase; tyrosine-dependent 98.61
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.61
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.52
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.46
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.43
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 97.93
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 97.9
1y7t_A327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.3
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 97.12
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 96.02
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 93.24
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 90.56
3qp9_A 525 Type I polyketide synthase pikaii; rossmann fold, 88.34
1b8p_A329 Protein (malate dehydrogenase); oxidoreductase; 1. 87.73
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 84.34
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 83.73
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 82.8
1vjp_A394 MYO-inositol-1-phosphate synthase-related protein; 81.76
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 81.73
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 80.48
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
Probab=100.00  E-value=5.2e-44  Score=284.06  Aligned_cols=205  Identities=19%  Similarity=0.218  Sum_probs=184.1

Q ss_pred             CCcCCHHHHHHHHHHHHhhcCCCceEEEeccCCCHHHHHHHHHHHhhcCCCceEEEeccccCCCC---CCCCcchhhhhh
Q 025633            1 MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENN---RLITSEGFELNF   77 (250)
Q Consensus         1 l~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dls~~~~v~~~~~~~~~~~g~id~lv~~ag~~~~~---~~~~~~~~~~~~   77 (250)
                      +++|++++++++.++++..++  ++.++.+|++++++++++++++.++||+||+||||||+....   .+.+.++|+++|
T Consensus        36 ~~~~~~~~~~~~~~~i~~~g~--~~~~~~~Dvt~~~~v~~~~~~~~~~~G~iDiLVNNAGi~~~~~~~~~~~~e~~~~~~  113 (254)
T 4fn4_A           36 AVELLEDRLNQIVQELRGMGK--EVLGVKADVSKKKDVEEFVRRTFETYSRIDVLCNNAGIMDGVTPVAEVSDELWERVL  113 (254)
T ss_dssp             EEESCHHHHHHHHHHHHHTTC--CEEEEECCTTSHHHHHHHHHHHHHHHSCCCEEEECCCCCCTTCCGGGCCHHHHHHHH
T ss_pred             EEECCHHHHHHHHHHHHhcCC--cEEEEEccCCCHHHHHHHHHHHHHHcCCCCEEEECCcccCCCCChhhCCHHHHHHHH
Confidence            368999999999999988755  899999999999999999999999999999999999976532   367899999999


Q ss_pred             hhhhhhHHHHHHHhHHHHhhhCCCCEEEEEecCcccccccCCccccCCCCCCchhHHHHHHHHHHHHHHHHHHHhccCCe
Q 025633           78 AVNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGI  157 (250)
Q Consensus        78 ~~n~~~~~~l~~~~~~~l~~~~~~~~iv~vss~~~~~~~~~~~~~~~~~~~~~~~~Y~~sK~a~~~~~~~la~e~~~~~i  157 (250)
                      ++|+.|+|+++|+++|+|+++ +.|+||++||..+..            +.++..+|++||+|+.+|+|++|.|++++||
T Consensus       114 ~vNl~g~~~~~~~~~p~m~~~-~~G~IVnisS~~g~~------------~~~~~~~Y~asKaal~~ltr~lA~ela~~gI  180 (254)
T 4fn4_A          114 AVNLYSAFYSSRAVIPIMLKQ-GKGVIVNTASIAGIR------------GGFAGAPYTVAKHGLIGLTRSIAAHYGDQGI  180 (254)
T ss_dssp             HHHTHHHHHHHHHHHHHHHHH-TCEEEEEECCGGGTC------------SSSSCHHHHHHHHHHHHHHHHHHHHHGGGTE
T ss_pred             HHHhHHHHHHHHHHHHHHHHc-CCcEEEEEechhhcC------------CCCCChHHHHHHHHHHHHHHHHHHHhhhhCe
Confidence            999999999999999999998 789999999999987            7788899999999999999999999999999


Q ss_pred             EEEEecCccccCCcccccccch-------H--HHhhccCCCHHHHHhHhhHhhccCCCCCCCceeeecCCCc
Q 025633          158 GFYSMHPGWAETPGVAKSMPSF-------N--ERFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEA  220 (250)
Q Consensus       158 ~v~~v~PG~v~t~~~~~~~~~~-------~--~~~~~~~~~p~~~a~~~~~l~~~~~~~~~~g~~~~~~~~~  220 (250)
                      |||+|+||+|+|++........       .  ..+.+++.+|+|+|+.++||+++.+.+++|..+.+|||..
T Consensus       181 rVN~V~PG~i~T~~~~~~~~~~~~~~~~~~~~~~~~~R~g~pediA~~v~fLaSd~a~~iTG~~i~VDGG~t  252 (254)
T 4fn4_A          181 RAVAVLPGTVKTNIGLGSSKPSELGMRTLTKLMSLSSRLAEPEDIANVIVFLASDEASFVNGDAVVVDGGLT  252 (254)
T ss_dssp             EEEEEEECSBCSSCTTSCSSCCHHHHHHHHHHHTTCCCCBCHHHHHHHHHHHHSGGGTTCCSCEEEESTTGG
T ss_pred             EEEEEEeCCCCCcccccccCCcHHHHHHHHhcCCCCCCCcCHHHHHHHHHHHhCchhcCCcCCEEEeCCCcc
Confidence            9999999999999865433211       1  1135788999999999999999999999999999999854



>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1vjp_A MYO-inositol-1-phosphate synthase-related protein; TM1419, structural genomics, JCSG, PSI, protein structure initiative; HET: NAD; 1.70A {Thermotoga maritima} PDB: 3cin_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 250
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 3e-26
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 2e-20
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 5e-19
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 6e-17
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 6e-16
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 8e-16
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 2e-15
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 2e-15
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 4e-15
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 7e-15
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 1e-14
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 2e-14
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 2e-14
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3e-14
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 5e-14
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 7e-14
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 1e-13
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 1e-13
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-13
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 3e-13
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 4e-13
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 2e-12
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 2e-12
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 4e-12
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 7e-12
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 7e-12
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 9e-12
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 1e-11
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 2e-11
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 2e-10
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 2e-10
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 5e-10
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 8e-10
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 2e-09
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 3e-09
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 5e-09
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 1e-08
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 2e-08
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 3e-08
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 3e-08
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 5e-08
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 8e-08
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-07
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 2e-07
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 3e-07
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 5e-07
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 5e-07
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-06
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-06
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 2e-06
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 4e-06
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 9e-06
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 1e-05
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 2e-05
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 2e-05
d1fjha_257 c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase 3e-05
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 6e-05
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 1e-04
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-04
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Carbonyl reductase/20beta-hydroxysteroid dehydrogenase
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  101 bits (252), Expect = 3e-26
 Identities = 48/257 (18%), Positives = 84/257 (32%), Gaps = 51/257 (19%)

Query: 1   MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAG 60
           +  R   +G+ A+  ++++  +        D+  +  I++  +    +   + VLVNNAG
Sbjct: 33  LTARDVTRGQAAVQQLQAEGLS--PRFHQLDIDDLQSIRALRDFLRKEYGGLDVLVNNAG 90

Query: 61  VLENNRL--ITSEGFELNFAVNVLGTYTITESMVPLLEKAAPDARVITVSS--------- 109
           +              E+    N  GT  +   ++PL++      RV+ VSS         
Sbjct: 91  IAFKVADPTPFHIQAEVTMKTNFFGTRDVCTELLPLIKPQG---RVVNVSSIMSVRALKS 147

Query: 110 --------------------GGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTE--- 146
                               G M           +         Y   K     L+    
Sbjct: 148 CSPELQQKFRSETITEEELVGLMNKFVEDTKKGVHQKEGWPSSAYGVTKIGVTVLSRIHA 207

Query: 147 -KWSEMYKEKGIGFYSMHPGWAETPGVAKSMPSFNERFAGNLRTSEEGADTVLWLALQPK 205
            K SE  K   I   +  PGW  T                  ++ EEGA+T ++LAL P 
Sbjct: 208 RKLSEQRKGDKILLNACCPGWVRTDMAGPKAT----------KSPEEGAETPVYLALLPP 257

Query: 206 E-KLVSGSFYFDRAEAP 221
           + +   G F  ++    
Sbjct: 258 DAEGPHGQFVSEKRVEQ 274


>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 257 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query250
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 100.0
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 100.0
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.97
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.97
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.97
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.97
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.97
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.97
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.96
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.96
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.95
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.95
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.95
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.94
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.94
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.91
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.88
d1db3a_357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.42
d1kewa_361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.19
d1udca_338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.19
d1r6da_322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 99.1
d1rpna_321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 99.05
d1t2aa_347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 99.02
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.98
d1oc2a_346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.95
d1z45a2347 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.94
d1e6ua_315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.94
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.93
d1i24a_393 Sulfolipid biosynthesis protein SQD1 {Thale cress 98.88
d2blla1342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.87
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.82
d1sb8a_341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.78
d1n7ha_339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.78
d1gy8a_383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.76
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 98.75
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.64
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.61
d1orra_338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.52
d1rkxa_356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.3
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 98.19
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 98.15
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.95
d1n2sa_298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 97.95
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 97.74
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.08
d1eq2a_307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 96.73
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 95.02
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 94.76
d1xgka_350 Negative transcriptional regulator NmrA {Aspergill 89.83
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 80.47
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: beta-keto acyl carrier protein reductase
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]
Probab=100.00  E-value=1.1e-42  Score=275.73  Aligned_cols=205  Identities=21%  Similarity=0.260  Sum_probs=182.7

Q ss_pred             CCcCCHHHHHHHHHHHHhhcCCCceEEEeccCCCHHHHHHHHHHHhhcCCCceEEEeccccCCCCC--CCCcchhhhhhh
Q 025633            1 MVCRSKEKGETALSAIRSKTGNENVHLELCDLSSITEIKSFANRFSLKNKPVHVLVNNAGVLENNR--LITSEGFELNFA   78 (250)
Q Consensus         1 l~~r~~~~~~~~~~~l~~~~~~~~~~~~~~Dls~~~~v~~~~~~~~~~~g~id~lv~~ag~~~~~~--~~~~~~~~~~~~   78 (250)
                      +++||+++++++++++++.++  ++.++.+|++++++++++++++.+++|++|+||||||+.....  +.+.++|+++++
T Consensus        39 ~~~r~~~~l~~~~~~l~~~g~--~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iDilvnnag~~~~~~~~~~~~~~~~~~~~  116 (251)
T d2c07a1          39 CISRTQKSCDSVVDEIKSFGY--ESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRDNLFLRMKNDEWEDVLR  116 (251)
T ss_dssp             EEESSHHHHHHHHHHHHTTTC--CEEEEECCTTCHHHHHHHHHHHHHHCSCCCEEEECCCCCCCCCTTTCCHHHHHHHHH
T ss_pred             EEECCHHHHHHHHHHHHhcCC--cEEEEEccCCCHHHHHHHHHHHHHhcCCceeeeeccccccccccccccHHHHhhhhe
Confidence            468999999999999988754  7999999999999999999999999999999999999877653  568899999999


Q ss_pred             hhhhhHHHHHHHhHHHHhhhCCCCEEEEEecCcccccccCCccccCCCCCCchhHHHHHHHHHHHHHHHHHHHhccCCeE
Q 025633           79 VNVLGTYTITESMVPLLEKAAPDARVITVSSGGMYTAHLTDDLEFNSGSFDGMEQYARNKRVQVALTEKWSEMYKEKGIG  158 (250)
Q Consensus        79 ~n~~~~~~l~~~~~~~l~~~~~~~~iv~vss~~~~~~~~~~~~~~~~~~~~~~~~Y~~sK~a~~~~~~~la~e~~~~~i~  158 (250)
                      +|+.++++++++++|.|+++ +.|+||++||..+..            +.++..+|++||+|+.+|+|++|.|++++|||
T Consensus       117 vNl~~~~~~~~~~~~~m~~~-~~G~IVnisS~~~~~------------~~~~~~~Y~asKaal~~ltr~lA~el~~~gIr  183 (251)
T d2c07a1         117 TNLNSLFYITQPISKRMINN-RYGRIINISSIVGLT------------GNVGQANYSSSKAGVIGFTKSLAKELASRNIT  183 (251)
T ss_dssp             HHTTHHHHHHHHHHHHHHHH-TCEEEEEECCTHHHH------------CCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEE
T ss_pred             eeehhhhhhhhhcCcccccC-CCeEEEEECCHHhcC------------CCCCCHHHHHHHHHHHHHHHHHHHHhhhhCeE
Confidence            99999999999999999998 889999999999987            78889999999999999999999999999999


Q ss_pred             EEEecCccccCCcccccccchHH-----HhhccCCCHHHHHhHhhHhhccCCCCCCCceeeecCCCc
Q 025633          159 FYSMHPGWAETPGVAKSMPSFNE-----RFAGNLRTSEEGADTVLWLALQPKEKLVSGSFYFDRAEA  220 (250)
Q Consensus       159 v~~v~PG~v~t~~~~~~~~~~~~-----~~~~~~~~p~~~a~~~~~l~~~~~~~~~~g~~~~~~~~~  220 (250)
                      ||+|+||+++|++.....+...+     .+++++.+|+|+|+.++||+++.+.+++|..+.+|||..
T Consensus       184 VN~V~PG~v~T~~~~~~~~~~~~~~~~~~pl~R~~~pedvA~~v~fL~S~~s~~itG~~i~vDGG~s  250 (251)
T d2c07a1         184 VNAIAPGFISSDMTDKISEQIKKNIISNIPAGRMGTPEEVANLACFLSSDKSGYINGRVFVIDGGLS  250 (251)
T ss_dssp             EEEEEECSBCC-----CCHHHHHHHHTTCTTSSCBCHHHHHHHHHHHHSGGGTTCCSCEEEESTTSC
T ss_pred             EEEEccCCEecccccccCHHHHHHHHhcCCCCCCcCHHHHHHHHHHHhCchhCCCcCcEEEECCCcC
Confidence            99999999999998765544332     246788999999999999999999999999999999964



>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure